Capra hircus (goat): 102172640 Help Entry 102172640         CDS       T02910                                  Symbol NXT1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism chx  Capra hircus (goat) Pathway chx03008   Ribosome biogenesis in eukaryotes chx03013   Nucleocytoplasmic transport chx03015   mRNA surveillance pathway chx05014   Amyotrophic lateral sclerosis chx05164   Influenza A Brite KEGG Orthology (KO) [BR:chx00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     102172640 (NXT1)    03015 mRNA surveillance pathway     102172640 (NXT1)    03008 Ribosome biogenesis in eukaryotes     102172640 (NXT1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102172640 (NXT1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102172640 (NXT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:chx03019]     102172640 (NXT1)    03009 Ribosome biogenesis [BR:chx03009]     102172640 (NXT1) Messenger RNA biogenesis [BR:chx03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      102172640 (NXT1) Ribosome biogenesis [BR:chx03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     102172640 (NXT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NTF2 NXF_NTF2 Glyco_tran_10_N Cofilin_ADF Motif Other DBs NCBI-GeneID:  102172640 NCBI-ProteinID:  XP_005688145 UniProt:  A0A8C2R5K4 LinkDB All DBs Position 13:41373210..41376116 Genome browser AA seq 140 aa AA seqDB search MASVDFKTYVDQACRAAEEFVNVYYSTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS PSNTVWKIASDCFRFQDWAC NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcgtccgtggacttcaagacctatgtggaccaggcgtgccgcgcagctgaggagttc gtgaacgtgtactacagcaccatggacaagcggcggcggctgctgtcccgcctgtacatg ggcacagccaccctggtgtggaacggcaacgctgtctccgggcaagagtccctgagtgag ttttttgagatgctgccttccagtgagttccagatcaacgtggtagactgccagcctgtc catgacgaagccaccccgagccagaccacggtccttgtggtgatctgtgggacagtgaag tttgagggcaacaaacagcgagacttcaaccagaacttcatcctgacggcccaggcctca cccagcaacacagtgtggaagattgccagcgactgcttccggttccaggactgggcctgc tag

DBGET integrated database retrieval system