KEGG   Capra hircus (goat): 102175796
Entry
102175796         CDS       T02910                                 
Symbol
PSMB3
Name
(RefSeq) proteasome subunit beta type-3
  KO
K02735  20S proteasome subunit beta 3 [EC:3.4.25.1]
Organism
chx  Capra hircus (goat)
Pathway
chx03050  Proteasome
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    102175796 (PSMB3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102175796 (PSMB3)
   05012 Parkinson disease
    102175796 (PSMB3)
   05014 Amyotrophic lateral sclerosis
    102175796 (PSMB3)
   05016 Huntington disease
    102175796 (PSMB3)
   05017 Spinocerebellar ataxia
    102175796 (PSMB3)
   05020 Prion disease
    102175796 (PSMB3)
   05022 Pathways of neurodegeneration - multiple diseases
    102175796 (PSMB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:chx01002]
    102175796 (PSMB3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:chx03051]
    102175796 (PSMB3)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     102175796 (PSMB3)
Peptidases and inhibitors [BR:chx01002]
 Threonine peptidases
  Family T1: proteasome family
   102175796 (PSMB3)
Proteasome [BR:chx03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    102175796 (PSMB3)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 102175796
NCBI-ProteinID: XP_005693784
UniProt: A0A452EB57
LinkDB
Position
19:39001726..39010492
AA seq 205 aa
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCTEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAV
SGMGVIVHIIEKDKITTRTLKARMD
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtctattatgtcctataacggaggggccgtcatggccatgaaggggaagaactgtgtg
gccatcgctgctgacaggcgcttcgggatccaggcccagatggtgaccacggacttccag
aagatctttcccatgggcgaccgactgtacatcggcctggcgggtcttgccaccgacgtc
cagacagttgcccagcgcctcaagttccggctgaacctgtatgagctgaaggaaggcagg
cagatcaaaccttacaccctcatgagcatggtggccaacctcctgtacgagaaacggttt
gggccctactacacggagccggtcattgccggattggacccgaagacctttaagcctttc
atttgctctctagaccttattggctgccccatggtgaccgatgactttgtagtcagtggt
acctgcactgaacaaatgtacgggatgtgcgagtctctctgggagcccaacatggatcca
gagcacctgtttgaaaccatctcacaagccatgctgaatgctgtggacagggatgcggtg
tcaggcatgggagtcattgtccacatcattgagaaggacaaaatcaccacgaggacactg
aaggcccgcatggactaa

DBGET integrated database retrieval system