Capra hircus (goat): 102176581 Help Entry 102176581         CDS       T02910                                  Symbol CAV2 Name (RefSeq) caveolin-2 isoform X1   KO K12958   caveolin 2 Organism chx  Capra hircus (goat) Pathway chx04144   Endocytosis chx04510   Focal adhesion chx05020   Prion disease chx05100   Bacterial invasion of epithelial cells chx05205   Proteoglycans in cancer chx05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102176581 (CAV2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102176581 (CAV2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102176581 (CAV2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     102176581 (CAV2)   09164 Neurodegenerative disease    05020 Prion disease     102176581 (CAV2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102176581 (CAV2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:chx04131]     102176581 (CAV2) Membrane trafficking [BR:chx04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     102176581 (CAV2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  102176581 NCBI-ProteinID:  XP_013818766 UniProt:  A0A452EF60 LinkDB All DBs Position 4:68384848..68392321 Genome browser AA seq 162 aa AA seqDB search MGLETEKADVQLFMDDDSYSRHSSVDYADPDKFVDPGSDRDPHRLNSHLKVGFEDVIAEP VSTHSFDKVWICSHALFEMSKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFVK TCLMVLPSVQTIWKSVTDVVIAPLCTSVGRSFSSVSLQLSHD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggggctggagaccgagaaggcggatgtccagctcttcatggacgacgactcctacagc cgccacagcagcgtcgattacgcagacccggacaagtttgtggacccaggcagcgaccga gatccccacaggctcaattcgcatctcaaggtgggattcgaggatgtgattgcagagcca gtgtctacgcactcctttgacaaagtgtggatctgcagccatgctctctttgaaatgagc aaatacgtgatctacaagttcctgacggtgttcctggctattcccttggctttcgctgcg ggaattctctttgccaccctcagctgtctgcatatctggattataatgccttttgtaaag acctgcctaatggtcctgccttcagtgcagacaatatggaagagtgtgacagatgttgtc attgccccattgtgtacgagtgtaggacgcagcttctcttctgtcagcctgcaactgagc cacgattga

DBGET integrated database retrieval system