Capra hircus (goat): 102179943 Help Entry 102179943         CDS       T02910                                  Name (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04936   Alcoholic liver disease chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05320   Autoimmune thyroid disease chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102179943    04151 PI3K-Akt signaling pathway     102179943   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102179943  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102179943  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102179943    04621 NOD-like receptor signaling pathway     102179943    04622 RIG-I-like receptor signaling pathway     102179943    04623 Cytosolic DNA-sensing pathway     102179943    04650 Natural killer cell mediated cytotoxicity     102179943  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102179943   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102179943    05161 Hepatitis B     102179943    05160 Hepatitis C     102179943    05171 Coronavirus disease - COVID-19     102179943    05164 Influenza A     102179943    05162 Measles     102179943    05168 Herpes simplex virus 1 infection     102179943    05163 Human cytomegalovirus infection     102179943    05167 Kaposi sarcoma-associated herpesvirus infection     102179943    05169 Epstein-Barr virus infection     102179943    05165 Human papillomavirus infection     102179943   09171 Infectious disease: bacterial    05152 Tuberculosis     102179943   09163 Immune disease    05320 Autoimmune thyroid disease     102179943   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102179943   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102179943  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102179943 Cytokines and neuropeptides [BR:chx04052]  Cytokines   Interferons    102179943 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  102179943 NCBI-ProteinID:  XP_017908297 UniProt:  A0A452DRM0 LinkDB All DBs Position 8:22956562..22957131 Genome browser AA seq 189 aa AA seqDB search MAAAWSLLLALLLLSCNAICSWGCHLPHTHSLANGRVLMLLRQLRRVSPSSCLQDRKDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSIN LQERFRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccgcagcctggtccttactcctggctttgctgctgctcagctgcaacgccatctgc tcttggggctgccacctgcctcacacccacagcctggccaacgggagggttctgatgctc ctgcgacaactgaggagagtctccccttcctcctgcctgcaggacagaaaagacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcaccgagggctcggccgccgcgtgg gaccagagcctcctggacaagctccgtgctgcactggatcagcagctcactgacctgcaa gcatgtctcaggcaggaggaggggctgcgaggggctcctctgctcaaggaggattccagc ctggctgtgaggaaatactttcacagagtcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaataaac ttgcaggagagattcaggagcaaggactga

DBGET integrated database retrieval system