Capra hircus (goat): 102180554 Help Entry 102180554         CDS       T02910                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism chx  Capra hircus (goat) Pathway chx04613   Neutrophil extracellular trap formation chx05034   Alcoholism chx05202   Transcriptional misregulation in cancer chx05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:chx00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102180554  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102180554   09163 Immune disease    05322 Systemic lupus erythematosus     102180554   09165 Substance dependence    05034 Alcoholism     102180554  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     102180554   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102180554 Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102180554 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102180554 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  102180554 NCBI-ProteinID:  XP_017901510 UniProt:  A0A452E2C2 LinkDB All DBs Position 3:99422595..99423331 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaagtcgaccggtggcaaggccccgcggaagcag ctggccaccaaggcggctcgcaagagcgcgccggccacgggcggcgtcaagaagccgcat cgctaccggccgggtaccgtggccctgcgggagatccggcgctaccagaagtcgaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgtttgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatc atgcccaaagacatccagctggctcgtcgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system