Capra hircus (goat): 102180684 Help Entry 102180684         CDS       T02910                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism chx  Capra hircus (goat) Pathway chx01521   EGFR tyrosine kinase inhibitor resistance chx01524   Platinum drug resistance chx04014   Ras signaling pathway chx04064   NF-kappa B signaling pathway chx04115   p53 signaling pathway chx04137   Mitophagy - animal chx04140   Autophagy - animal chx04151   PI3K-Akt signaling pathway chx04210   Apoptosis chx04215   Apoptosis - multiple species chx04621   NOD-like receptor signaling pathway chx04630   JAK-STAT signaling pathway chx05012   Parkinson disease chx05014   Amyotrophic lateral sclerosis chx05022   Pathways of neurodegeneration - multiple diseases chx05145   Toxoplasmosis chx05162   Measles chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05170   Human immunodeficiency virus 1 infection chx05200   Pathways in cancer chx05202   Transcriptional misregulation in cancer chx05212   Pancreatic cancer chx05220   Chronic myeloid leukemia chx05222   Small cell lung cancer chx05225   Hepatocellular carcinoma chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102180684 (BCL2L1)    04630 JAK-STAT signaling pathway     102180684 (BCL2L1)    04064 NF-kappa B signaling pathway     102180684 (BCL2L1)    04151 PI3K-Akt signaling pathway     102180684 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102180684 (BCL2L1)    04137 Mitophagy - animal     102180684 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     102180684 (BCL2L1)    04215 Apoptosis - multiple species     102180684 (BCL2L1)    04115 p53 signaling pathway     102180684 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102180684 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102180684 (BCL2L1)    05202 Transcriptional misregulation in cancer     102180684 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     102180684 (BCL2L1)    05225 Hepatocellular carcinoma     102180684 (BCL2L1)    05220 Chronic myeloid leukemia     102180684 (BCL2L1)    05222 Small cell lung cancer     102180684 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102180684 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     102180684 (BCL2L1)    05162 Measles     102180684 (BCL2L1)    05168 Herpes simplex virus 1 infection     102180684 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102180684 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     102180684 (BCL2L1)    05014 Amyotrophic lateral sclerosis     102180684 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     102180684 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102180684 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102180684 (BCL2L1)    01524 Platinum drug resistance     102180684 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:chx01009]     102180684 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     102180684 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:chx02000]     102180684 (BCL2L1) Protein phosphatases and associated proteins [BR:chx01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102180684 (BCL2L1) Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102180684 (BCL2L1) Transporters [BR:chx02000]  Other transporters   Pores ion channels [TC:1]    102180684 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102180684 NCBI-ProteinID:  XP_017913170 UniProt:  A0A452FWV3 LinkDB All DBs Position 13:complement(60528848..60582326) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLA DSPAVNGATGHSRSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcttacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg acagaatcagatatggaaacccccagtgccatcaatggcaacccatcttggcacctggcg gatagccctgcggtgaatggagccaccggccacagcagaagcttggatgcccgggaagtg atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg taccgacgggcattcagcgacctgacgtcccagctccacattaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggctacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacgtttgtggaactctatgggaacaacgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system