Capra hircus (goat): 102180845 Help Entry 102180845         CDS       T02910                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism chx  Capra hircus (goat) Pathway chx04613   Neutrophil extracellular trap formation chx05034   Alcoholism chx05203   Viral carcinogenesis chx05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:chx00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102180845  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102180845   09163 Immune disease    05322 Systemic lupus erythematosus     102180845   09165 Substance dependence    05034 Alcoholism     102180845  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     102180845   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102180845 Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102180845 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102180845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  102180845 NCBI-ProteinID:  XP_005701752 UniProt:  A0A452E1V4 LinkDB All DBs Position 23:18994065..18994477 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagccaagtccgctccagccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg ggcatcatgaattcgttcgtgaacgatattttcgagcgcatcgcgggcgaggcgtcgcgc ctggctcattacaacaagcgctcgaccatcacatccagggagatccagacggctgtgcgc ctgctgctgcccggggagttggccaagcacgccgtgtctgagggcactaaggcggtcacc aagtataccagttccaagtga

DBGET integrated database retrieval system