Capra hircus (goat): 102180880 Help Entry 102180880         CDS       T02910                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04061   Viral protein interaction with cytokine and cytokine receptor chx04062   Chemokine signaling pathway chx04064   NF-kappa B signaling pathway chx04620   Toll-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102180880   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102180880    04061 Viral protein interaction with cytokine and cytokine receptor     102180880  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102180880    04623 Cytosolic DNA-sensing pathway     102180880    04062 Chemokine signaling pathway     102180880  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102180880  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102180880 Cytokines and neuropeptides [BR:chx04052]  Cytokines   Chemokines    102180880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102180880 NCBI-ProteinID:  XP_005693228 EnsemblRapid:  ENSCHIG00000026450 UniProt:  A0A452G7P7 LinkDB All DBs Position 19:complement(13984239..13985957) Genome browser AA seq 92 aa AA seqDB search MKLCVTVLSLLVLAAAFCSPALSAPMGSDPPTACCFSYTLRQIPRSFVIDYYETSSLCSQ PAVVFQTKKGRQVCANPSEPWVQEYMDDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgtgtgactgtcctgtccctcctcgtgctcgctgctgccttctgttctccg gcgctctcagcaccaatgggctcagaccctcccacggcctgttgcttctcttacaccctg cggcagattcctcgcagctttgtgattgactactacgagaccagcagcctctgctcccag ccagccgtggtattccagaccaaaaagggcaggcaggtctgcgccaaccccagtgagccc tgggtccaggagtacatggatgacctcgaactgaactga

DBGET integrated database retrieval system