KEGG   Capra hircus (goat): 102180910
Entry
102180910         CDS       T02910                                 
Symbol
ITGAX
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
chx  Capra hircus (goat)
Pathway
chx04610  Complement and coagulation cascades
chx04810  Regulation of actin cytoskeleton
chx05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102180910 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102180910 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102180910 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:chx04515]
    102180910 (ITGAX)
   04090 CD molecules [BR:chx04090]
    102180910 (ITGAX)
Cell adhesion molecules [BR:chx04515]
 Integrins
  Integrin alpha subunits
   102180910 (ITGAX)
CD molecules [BR:chx04090]
 Proteins
  102180910 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 102180910
NCBI-ProteinID: XP_017896048
LinkDB
Position
25:27280517..27300394
AA seq 1166 aa
MPMSDLLIMTVTQVFLFLLMAPVSSLCFNLDMEQPTTFRVDSPGFGHSVVQYAQWLVVGA
PQEVKAANQTGGLYWCDYSMGRCEAIPLQVPPEAVNMSLGLSLAATTDPFQLLACGPTVH
HACRENMHLTGICFLLASPFQQVKRIPAALQECPRQDQDIAFLIDGSGSISSRDFNKMLS
FVKAVMSQFQRPSSQFSLVQFSDRFQEHFTFKDFATSSDPLNLLNSVWQLRGWTFTASAI
RFVTDRLLSAAYGARKDASKILIVITDGEKTEKVDYKEVIPRAEAAGIIRYAIGVGSAFR
YRNSLQELIDIASTPSKEHVFQVENFDALRDIQKQLKEKIFAIEGTQTISSSSFELEMSQ
EGFSGVFMPDGPVLGAVGSFSWSGGAFLYPPNKNPTFINMSQEHVDMRDSYLGYSTELAL
WKGVQSLILGAPRHQHTGKVVLFTQVSGQWRLKAEVTGTQTGSYFGASLCSVDVNGDSSS
DLVLIGAPHFYEQTHGGQVSVCPFPQGRTKWKCDAVLRGEPGHPWGRFGAALTVLGDVNG
DRLADVAIGAPGEQENRGAVYLFHGTSELGISPSHSQRVTGAQLSPSLQYFGQSLSGGQD
LTQDGLADLAVGAQGHALLLRTRPVLRMWANIHITPTEIARSVYECEPLATFPHDLGKAT
VCLHVSQSPKNQLVNLQSIVTFDLTLDPGRLSPRAIFQETRTRNLTRVQELGLKQHCEAV
RLLLPDCVEDSVTPIILRLNFSLVGKPISSLRNLQPMLAVDAQRYFTTSLPFEKNCGADH
VCQDDLSISFGVSDLKTLMVGSNLELNLKVRVWNDGEDSYGTAVTFFYPPGLSYRRVTGG
QNHLQSRSLRLTCDSAPAGTQGTRSTRCSVNHFIFREGAQITFTVTFHVSPTATLGDKLL
LVANVSSENNSPKTSKTTFQLELPVKYAVYTVISSHEQSTKYLNFSASQEEGSREAQHRY
QVNNLGQRELPVSIDISVPMELNQVAVWKDIEVLNPQNPSIQCSSERTAPTESDFLTHFK
KKPVLDCSIADCLRFRCDIPSFGIQEELDFILKGNLSFRWVSQTQQKKVLVVSVAEITFN
RLVYSQLPGQETFLRAQTELVLEKYEVYNPIPLVVGSSVGGLLLLALITALLYKVGFFKR
QYREMMEGANKQTVPENETGDPQVAQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgcctatgtctgaccttcttatcatgacggtgacccaggtttttctcttcctgttgatg
gccccggtgtcctctctctgcttcaacttggacatggagcaaccgacaaccttccgtgtg
gacagccctgggtttggacacagtgtggtccagtatgcccaatggctggtggttggagcc
ccccaggaggtaaaggctgccaaccaaacaggcggcctctactggtgcgactacagcatg
ggcaggtgtgaggccatccccctgcaggtgcctccagaggctgtgaacatgtccctgggc
ctgtccctggcagccaccaccgacccctttcagctgctggcctgtggccccactgtgcac
catgcatgccgggagaacatgcacttgaccgggatctgcttcctgctggcctccccgttc
cagcaggtcaagaggatcccggctgccctgcaggagtgcccaaggcaggatcaggacatc
gcctttctgatcgacggctcaggcagcatctcctccagagattttaacaaaatgttgagc
ttcgtgaaggccgtgatgagccagttccagcgtcccagctcccagttctccctggtgcag
ttctcagaccggttccaggagcacttcactttcaaagacttcgctaccagctcagaccca
ctaaacctcctgaattccgtctggcagctgcgagggtggacgttcacggcctcagctatc
cgattcgtcacagatcgactgctcagtgccgcctacggggcccgaaaagacgcctccaaa
atcctcatcgtcatcactgatggggagaaaacagaaaaggtggattacaaggaggtcatt
ccccgggctgaggccgccggcatcatccgatatgcaattggggtgggatcagcatttcga
tacagaaattccttgcaagaattaatcgacattgcctccacaccctctaaagagcatgta
tttcaagtggagaactttgacgctttgcgagacattcagaaacaactgaaagagaagatc
tttgccattgagggtacgcagaccataagcagtagttccttcgaactggagatgtctcag
gagggcttcagtggtgtgttcatgcctgatggaccagttctgggggctgtggggagcttc
agctggtctggaggtgctttcctgtaccccccaaataagaaccccaccttcatcaacatg
tcccaggagcacgtggacatgagggactcttacctgggttactccacagagctggccctt
tggaagggggtccagagcctgatcctgggggccccccgccatcagcacaccgggaaggtg
gtcctctttacccaggtgtccgggcaatggaggctgaaggctgaagtcacagggacccag
accggctcctacttcggggcctccctctgctctgtggacgtgaatggagatagtagctct
gacctggtcctcatcggggcccctcatttctacgagcagacccacgggggccaggtgtcc
gtgtgcccctttcctcaggggaggactaagtggaagtgtgatgctgtcctgcgaggggag
ccgggccacccctggggccgctttggggcagccctgaccgtgctgggggatgtgaatggg
gacaggctggcggatgtggccattggggccccgggagagcaggagaaccggggtgctgtc
tacctgttccacggaacctcagaactgggcatcagcccctcccacagccagcgggtcaca
ggcgcccagctctcccccagcctccagtatttcgggcagtcgctgagcgggggtcaggac
ctcacccaggatggactggcagatttggccgtgggggcccaggggcacgcattgctgctc
aggaccagacctgtgctcaggatgtgggcgaacattcacatcacacccacggagatcgcc
aggtctgtgtatgagtgtgagccgctggcgacctttccccatgatctgggcaaggccact
gtctgcctgcatgtttcccaaagtcccaagaaccagctggttaacctccaaagcattgtg
acatttgacttaacccttgaccctggccgcctgagtcctcgtgccatcttccaagagacg
aggactcggaatctgacccgtgttcaagagctggggctgaagcagcactgcgaggctgtg
aggttgctccttccggactgtgtggaggactcagtgacccccatcatcttgcgtctcaac
ttctccctcgtgggcaagcccatctctagcctaagaaacctccagcctatgctggcagtg
gatgcccagagatacttcacaacctctctcccctttgagaagaactgtggcgcagatcac
gtctgccaggacgacctcagcatctcctttggggtctcagacttgaagaccctgatggta
gggagtaacctggagctgaacttgaaagtgagagtgtggaatgatggcgaggactcctat
ggaaccgcagtcaccttcttctaccctccagggttgtcttaccgacgtgtgaccgggggc
cagaaccatctgcagtcacgttccctgcgcctgacctgtgacagcgcccccgccgggacc
cagggcacccgaagcacccgctgtagcgtcaaccacttcatcttccgtgagggcgcccag
atcaccttcacggtcacctttcacgtctcccccacggccaccctgggagacaagctactt
cttgtcgccaatgtgagcagtgagaataacagccccaagacaagcaagaccaccttccag
ctggagctgcccgtgaagtatgctgtctacaccgtgatcagcagccacgaacaatccacc
aagtacctcaacttctcggcctcacaggaggagggcagcagggaggcccagcacagatac
caggtgaataacctggggcagagggagctgcctgtcagcatcgacatctcagtgcccatg
gagctgaaccaggtggccgtgtggaaggacatagaggtcctcaacccccagaacccctcc
attcagtgctcttcagagagaacagcacccacagagtctgacttcctgacccactttaag
aagaagcctgtcctggactgctccatcgctgactgcctgaggttccgctgtgacatcccc
tccttcggcatccaggaggaacttgacttcatcctgaagggcaacctcagcttccgctgg
gtcagccagacacagcagaagaaggtgctggtcgtgagcgtggctgaaatcaccttcaac
agacttgtgtattctcagcttccaggacaggagacatttttgagagctcagacggaactg
gtgctggagaagtatgaggtctacaaccccatccccctcgttgtgggcagctctgtggga
ggactgctgctcctggccctcatcacagccctactgtacaaggttggtttcttcaaacgt
cagtacagggaaatgatggaaggagcaaacaaacagactgtcccagaaaatgagacagga
gacccccaagttgcccaataa

DBGET integrated database retrieval system