Capra hircus (goat): 102180975 Help Entry 102180975         CDS       T02910                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism chx  Capra hircus (goat) Pathway chx04810   Regulation of actin cytoskeleton chx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:chx00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102180975 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102180975 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  102180975 NCBI-ProteinID:  XP_005695669 UniProt:  A0A452F877 LinkDB All DBs Position 22:complement(16552011..16559676) Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggacaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcagactttctcaactcattcgat atgtcttgtcgctcaaggctcgcaacactaaacgagaaattgacagctcttgaacggaga atagagtacatagaagccagggtgacaaaaggtgaaaccctcacctag

DBGET integrated database retrieval system