Capra hircus (goat): 102181154 Help Entry 102181154         CDS       T02910                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04061   Viral protein interaction with cytokine and cytokine receptor chx04062   Chemokine signaling pathway chx04620   Toll-like receptor signaling pathway chx05142   Chagas disease chx05163   Human cytomegalovirus infection chx05323   Rheumatoid arthritis chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102181154    04061 Viral protein interaction with cytokine and cytokine receptor     102181154  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102181154    04062 Chemokine signaling pathway     102181154  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102181154   09174 Infectious disease: parasitic    05142 Chagas disease     102181154   09163 Immune disease    05323 Rheumatoid arthritis     102181154   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102181154  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102181154    00536 Glycosaminoglycan binding proteins [BR:chx00536]     102181154 Cytokines and neuropeptides [BR:chx04052]  Cytokines   Chemokines    102181154 Glycosaminoglycan binding proteins [BR:chx00536]  Heparan sulfate / Heparin   Chemokines    102181154 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102181154 NCBI-ProteinID:  XP_005693229 UniProt:  A0A452EYB4 LinkDB All DBs Position 19:14003569..14005609 Genome browser AA seq 93 aa AA seqDB search MKAPAAALAVLLCTMALCSQVFSAPFGADTPTACCFSYAARQLSRKIIADYFETSSQCSK PGVIFQTKRGRQVCANPSEDWVQEYVTDLELNS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggcacccgcggctgctctcgctgttcttctctgcaccatggccctctgcagccag gtcttctcggcaccatttggcgctgacaccccaacggcctgctgcttctcctatgccgcc cggcagctttctcgcaaaatcatagctgactattttgagaccagcagccagtgctccaag cctggtgtcatcttccagaccaaaagaggccggcaggtgtgtgccaaccccagtgaggac tgggtccaggaatacgtcaccgacctggagctgaattcctga

DBGET integrated database retrieval system