Capra hircus (goat): 102181169 Help Entry 102181169         CDS       T02910                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism chx  Capra hircus (goat) Pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04022   cGMP-PKG signaling pathway chx04024   cAMP signaling pathway chx04062   Chemokine signaling pathway chx04071   Sphingolipid signaling pathway chx04072   Phospholipase D signaling pathway chx04081   Hormone signaling chx04144   Endocytosis chx04150   mTOR signaling pathway chx04270   Vascular smooth muscle contraction chx04310   Wnt signaling pathway chx04350   TGF-beta signaling pathway chx04360   Axon guidance chx04510   Focal adhesion chx04520   Adherens junction chx04530   Tight junction chx04611   Platelet activation chx04621   NOD-like receptor signaling pathway chx04625   C-type lectin receptor signaling pathway chx04660   T cell receptor signaling pathway chx04670   Leukocyte transendothelial migration chx04722   Neurotrophin signaling pathway chx04810   Regulation of actin cytoskeleton chx04921   Oxytocin signaling pathway chx04928   Parathyroid hormone synthesis, secretion and action chx04972   Pancreatic secretion chx05100   Bacterial invasion of epithelial cells chx05132   Salmonella infection chx05133   Pertussis chx05135   Yersinia infection chx05152   Tuberculosis chx05163   Human cytomegalovirus infection chx05200   Pathways in cancer chx05203   Viral carcinogenesis chx05205   Proteoglycans in cancer chx05206   MicroRNAs in cancer chx05210   Colorectal cancer chx05417   Lipid and atherosclerosis chx05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102181169 (RHOA)    04015 Rap1 signaling pathway     102181169 (RHOA)    04310 Wnt signaling pathway     102181169 (RHOA)    04350 TGF-beta signaling pathway     102181169 (RHOA)    04072 Phospholipase D signaling pathway     102181169 (RHOA)    04071 Sphingolipid signaling pathway     102181169 (RHOA)    04024 cAMP signaling pathway     102181169 (RHOA)    04022 cGMP-PKG signaling pathway     102181169 (RHOA)    04150 mTOR signaling pathway     102181169 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     102181169 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102181169 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102181169 (RHOA)    04520 Adherens junction     102181169 (RHOA)    04530 Tight junction     102181169 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102181169 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102181169 (RHOA)    04621 NOD-like receptor signaling pathway     102181169 (RHOA)    04625 C-type lectin receptor signaling pathway     102181169 (RHOA)    04660 T cell receptor signaling pathway     102181169 (RHOA)    04670 Leukocyte transendothelial migration     102181169 (RHOA)    04062 Chemokine signaling pathway     102181169 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     102181169 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     102181169 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102181169 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     102181169 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102181169 (RHOA)   09158 Development and regeneration    04360 Axon guidance     102181169 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102181169 (RHOA)    05206 MicroRNAs in cancer     102181169 (RHOA)    05205 Proteoglycans in cancer     102181169 (RHOA)    05203 Viral carcinogenesis     102181169 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     102181169 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102181169 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102181169 (RHOA)    05135 Yersinia infection     102181169 (RHOA)    05133 Pertussis     102181169 (RHOA)    05152 Tuberculosis     102181169 (RHOA)    05100 Bacterial invasion of epithelial cells     102181169 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102181169 (RHOA)    05418 Fluid shear stress and atherosclerosis     102181169 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:chx04131]     102181169 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102181169 (RHOA)    04031 GTP-binding proteins [BR:chx04031]     102181169 (RHOA) Membrane trafficking [BR:chx04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102181169 (RHOA) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102181169 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102181169 (RHOA)   Exosomal proteins of colorectal cancer cells    102181169 (RHOA)   Exosomal proteins of bladder cancer cells    102181169 (RHOA) GTP-binding proteins [BR:chx04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102181169 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  102181169 NCBI-ProteinID:  NP_001273372 UniProt:  I1VE57 LinkDB All DBs Position 22:50777269..50827164 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtccctacggtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcctctctcctacccggataccgacgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaacgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system