Capra hircus (goat): 102182415
Help
Entry
102182415 CDS
T02910
Symbol
PSMB7
Name
(RefSeq) proteasome subunit beta type-7
KO
K02739
20S proteasome subunit beta 2 [EC:
3.4.25.1
]
Organism
chx
Capra hircus (goat)
Pathway
chx03050
Proteasome
chx05010
Alzheimer disease
chx05012
Parkinson disease
chx05014
Amyotrophic lateral sclerosis
chx05016
Huntington disease
chx05017
Spinocerebellar ataxia
chx05020
Prion disease
chx05022
Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:
chx00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
102182415 (PSMB7)
09160 Human Diseases
09164 Neurodegenerative disease
05010 Alzheimer disease
102182415 (PSMB7)
05012 Parkinson disease
102182415 (PSMB7)
05014 Amyotrophic lateral sclerosis
102182415 (PSMB7)
05016 Huntington disease
102182415 (PSMB7)
05017 Spinocerebellar ataxia
102182415 (PSMB7)
05020 Prion disease
102182415 (PSMB7)
05022 Pathways of neurodegeneration - multiple diseases
102182415 (PSMB7)
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
chx01002
]
102182415 (PSMB7)
09182 Protein families: genetic information processing
03051 Proteasome [BR:
chx03051
]
102182415 (PSMB7)
Enzymes [BR:
chx01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.25 Threonine endopeptidases
3.4.25.1 proteasome endopeptidase complex
102182415 (PSMB7)
Peptidases and inhibitors [BR:
chx01002
]
Threonine peptidases
Family T1: proteasome family
102182415 (PSMB7)
Proteasome [BR:
chx03051
]
Eukaryotic proteasome
Core particles (20S proteasome)
beta type subunits
102182415 (PSMB7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Proteasome
Pr_beta_C
Motif
Other DBs
NCBI-GeneID:
102182415
NCBI-ProteinID:
XP_005687183
UniProt:
A0A452ET01
LinkDB
All DBs
Position
11:complement(94922900..94979454)
Genome browser
AA seq
277 aa
AA seq
DB search
MAAVSVYEPPVGGFSFDNCRRNAVLEADFAKKGYKLPTARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNVDLCVISKSKLDFLRPYSVPNKKGT
RFGRYRCEKGTTAVLTEKVTTLEIEVLEETVQTMDTS
NT seq
834 nt
NT seq
+upstream
nt +downstream
nt
atggcggctgtgtcagtgtatgaaccaccagttggaggtttctctttcgataactgccga
agaaatgccgtcttggaagccgattttgcaaagaaagggtacaagcttccaacggcccgg
aaaactgggacgactatcgcaggtgtggtctataaggatggcatagttcttggagcagat
acaagggcaactgaagggatggttgttgcggacaagaactgttcaaaaatacacttcata
tctcctaacatttattgttgtggtgctgggacagctgcagacacagacatgacaacccag
cttatttcttccaacttggagctccactccctttccaccggccgccttcccagagttgtg
acggccaaccggatgctgaagcagatgcttttcaggtatcaaggttacattggtgcagcc
ctagttttggggggagtagatgttactggacctcacctctacagcatctatcctcatgga
tcaactgataagttgccttatgtcaccatgggttcgggctccttggcagcgatggccgtg
tttgaagataaatttaggccagacatggaggaggaagaagctaagaagctggtgagtgaa
gccatagcagccgggatcttcaatgacctggggtctggaagtaacgttgacctgtgtgtc
atcagcaagagcaagctggattttctccgtccgtactcagtgcccaataagaaggggacc
aggtttggccggtacaggtgtgagaaagggaccactgctgtcctcactgaaaaagtcaca
accctggaaattgaggtgctggaagaaacagtccaaacaatggacacgtcctga
DBGET
integrated database retrieval system