Capra hircus (goat): 102183109 Help Entry 102183109         CDS       T02910                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism chx  Capra hircus (goat) Pathway chx04015   Rap1 signaling pathway chx04810   Regulation of actin cytoskeleton chx05014   Amyotrophic lateral sclerosis chx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102183109 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102183109 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102183109 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102183109 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:chx04131]     102183109 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:chx04812]     102183109 (PFN2)    04147 Exosome [BR:chx04147]     102183109 (PFN2) Membrane trafficking [BR:chx04131]  Others   Actin-binding proteins    Others     102183109 (PFN2) Cytoskeleton proteins [BR:chx04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102183109 (PFN2) Exosome [BR:chx04147]  Exosomal proteins   Proteins found in most exosomes    102183109 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102183109 NCBI-ProteinID:  XP_017904547 UniProt:  A0A452FL85 LinkDB All DBs Position 1:117789305..117796028 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaatggtttgactcttggtgcaaagaagtgctcagtgatcagagatagcctatacgtg gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgccgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system