Capra hircus (goat): 102183607 Help Entry 102183607         CDS       T02910                                  Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism chx  Capra hircus (goat) Pathway chx01521   EGFR tyrosine kinase inhibitor resistance chx01524   Platinum drug resistance chx04014   Ras signaling pathway chx04064   NF-kappa B signaling pathway chx04115   p53 signaling pathway chx04137   Mitophagy - animal chx04140   Autophagy - animal chx04151   PI3K-Akt signaling pathway chx04210   Apoptosis chx04215   Apoptosis - multiple species chx04621   NOD-like receptor signaling pathway chx04630   JAK-STAT signaling pathway chx05012   Parkinson disease chx05014   Amyotrophic lateral sclerosis chx05022   Pathways of neurodegeneration - multiple diseases chx05145   Toxoplasmosis chx05162   Measles chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05170   Human immunodeficiency virus 1 infection chx05200   Pathways in cancer chx05202   Transcriptional misregulation in cancer chx05212   Pancreatic cancer chx05220   Chronic myeloid leukemia chx05222   Small cell lung cancer chx05225   Hepatocellular carcinoma chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102183607    04630 JAK-STAT signaling pathway     102183607    04064 NF-kappa B signaling pathway     102183607    04151 PI3K-Akt signaling pathway     102183607  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102183607    04137 Mitophagy - animal     102183607   09143 Cell growth and death    04210 Apoptosis     102183607    04215 Apoptosis - multiple species     102183607    04115 p53 signaling pathway     102183607  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102183607  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102183607    05202 Transcriptional misregulation in cancer     102183607   09162 Cancer: specific types    05212 Pancreatic cancer     102183607    05225 Hepatocellular carcinoma     102183607    05220 Chronic myeloid leukemia     102183607    05222 Small cell lung cancer     102183607   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102183607    05170 Human immunodeficiency virus 1 infection     102183607    05162 Measles     102183607    05168 Herpes simplex virus 1 infection     102183607   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102183607   09164 Neurodegenerative disease    05012 Parkinson disease     102183607    05014 Amyotrophic lateral sclerosis     102183607    05022 Pathways of neurodegeneration - multiple diseases     102183607   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102183607   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102183607    01524 Platinum drug resistance     102183607  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:chx01009]     102183607   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     102183607   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:chx02000]     102183607 Protein phosphatases and associated proteins [BR:chx01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102183607 Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102183607 Transporters [BR:chx02000]  Other transporters   Pores ion channels [TC:1]    102183607 SSDB OrthologParalogGFIT Motif Pfam:  BH4 Bcl-2 Motif Other DBs NCBI-GeneID:  102183607 NCBI-ProteinID:  XP_005686508 LinkDB All DBs Position 11 Genome browser AA seq 173 aa AA seqDB search MSQSNRELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGTESDMETPSAISGNPSWHLA DSSVVNGATGHSRSLDAGKMIPTAVVKQALREASNECELRYQQTFSDLTSQLHITPGTTY QSFEQNGDWDIFVELYENNTATESQKGQEHFNRWSLTDVTVAGMALLGLLFNT NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggaactagtggttgactttctctcttacaagtttttccagaaa ggatacagctggagtcagtttagtgatatggaagagaacagaactgagaccctagaaggg acagaatcagatatggaaacccccagcgccatcagtggcaacccatcctggcacctggca gatagctctgtggtgaatggagccactggtcacagcagaagcttggacgctgggaaaatg atccccacggcagtggtgaagcaagccctgagggaggcaagcaatgagtgtgaattgagg taccaacagacattcagcgacctgacgtcccagctccacatcaccccagggacaacatat cagagctttgaacagaatggcgactgggacatttttgtggaactctacgaaaacaataca gcaaccgagagccaaaagggccaagagcacttcaaccgctggtccctgacggacgtgact gtggctggtatggctctgctgggcttgctcttcaacacataa

DBGET integrated database retrieval system