Capra hircus (goat): 102184042
Help
Entry
102184042 CDS
T02910
Symbol
DNAL4
Name
(RefSeq) dynein light chain 4, axonemal
KO
K10412
dynein axonemal light chain 4
Organism
chx
Capra hircus (goat)
Pathway
chx04814
Motor proteins
chx05014
Amyotrophic lateral sclerosis
chx05016
Huntington disease
chx05022
Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:
chx00001
]
09140 Cellular Processes
09142 Cell motility
04814 Motor proteins
102184042 (DNAL4)
09160 Human Diseases
09164 Neurodegenerative disease
05014 Amyotrophic lateral sclerosis
102184042 (DNAL4)
05016 Huntington disease
102184042 (DNAL4)
05022 Pathways of neurodegeneration - multiple diseases
102184042 (DNAL4)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
03037 Cilium and associated proteins [BR:
chx03037
]
102184042 (DNAL4)
04812 Cytoskeleton proteins [BR:
chx04812
]
102184042 (DNAL4)
Cilium and associated proteins [BR:
chx03037
]
Motile cilia and associated proteins
Dynein arm
102184042 (DNAL4)
Cytoskeleton proteins [BR:
chx04812
]
Eukaryotic cytoskeleton proteins
Microtubules
Tubulin-binding proteins
Dyneins
102184042 (DNAL4)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Dynein_light
DUF3109
Ground-like
Motif
Other DBs
NCBI-GeneID:
102184042
NCBI-ProteinID:
XP_017904268
UniProt:
A0A452F6V6
LinkDB
All DBs
Position
5:complement(109324766..109336586)
Genome browser
AA seq
105 aa
AA seq
DB search
MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET
MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
NT seq
318 nt
NT seq
+upstream
nt +downstream
nt
atgggagaaacagaagggaagaaagatgaggctgattataaacgactgcagaccttccct
ctggtcaggcactcggacatgccagaggagatgcgcgtggagaccatggagctgtgtgtc
acggcctgtgagaaattctccaacaacaacgagagcgctgccaagatgatcaaagagacc
atggacaagaagttcggctcctcctggcacgtggtgatcggcgaaggcttcggctttgag
atcacgcacgaggtgaagaacctcctctacctgtacttcgggggcaccctggctgtgtgt
gtctggaagtgctcctga
DBGET
integrated database retrieval system