Capra hircus (goat): 102185752 Help Entry 102185752         CDS       T02910                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism chx  Capra hircus (goat) Pathway chx03410   Base excision repair chx04140   Autophagy - animal chx04217   Necroptosis chx04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:chx00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     102185752 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102185752 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     102185752 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102185752 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     102185752 (HMGB1)    03400 DNA repair and recombination proteins [BR:chx03400]     102185752 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102185752 (HMGB1) Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     102185752 (HMGB1) DNA repair and recombination proteins [BR:chx03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      102185752 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      102185752 (HMGB1) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102185752 (HMGB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  102185752 NCBI-ProteinID:  XP_017912105 UniProt:  A0A452F540 LinkDB All DBs Position 12:complement(56376438..56383261) Genome browser AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEEEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacccggatgcttcagtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt gaagacatggcaaaggcggacaaggcccgttacgaaagagaaatgaaaacttatatccct cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg gcctttttcttgttttgttctgagtatcgtccaaaaatcaaaggcgaacatcctggcctg tccattggtgatgttgcaaagaaactgggagagatgtggaataacactgctgcggatgac aagcagccttatgagaagaaggctgctaagctgaaggaaaaatacgaaaaggatattgct gcataccgagctaaagggaagcctgatgcagcaaaaaagggagttgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaagaa gaagatgaagaggatgaggaggaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system