KEGG   Capra hircus (goat): 102186040
Entry
102186040         CDS       T02910                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04140  Autophagy - animal
chx04148  Efferocytosis
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04218  Cellular senescence
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04350  TGF-beta signaling pathway
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04371  Apelin signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04517  IgSF CAM signaling
chx04520  Adherens junction
chx04540  Gap junction
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04722  Neurotrophin signaling pathway
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04730  Long-term depression
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04926  Relaxin signaling pathway
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04930  Type II diabetes mellitus
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx05010  Alzheimer disease
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05034  Alcoholism
chx05132  Salmonella infection
chx05133  Pertussis
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05207  Chemical carcinogenesis - receptor activation
chx05208  Chemical carcinogenesis - reactive oxygen species
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05218  Melanoma
chx05219  Bladder cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102186040 (MAPK1)
   04012 ErbB signaling pathway
    102186040 (MAPK1)
   04014 Ras signaling pathway
    102186040 (MAPK1)
   04015 Rap1 signaling pathway
    102186040 (MAPK1)
   04350 TGF-beta signaling pathway
    102186040 (MAPK1)
   04370 VEGF signaling pathway
    102186040 (MAPK1)
   04371 Apelin signaling pathway
    102186040 (MAPK1)
   04668 TNF signaling pathway
    102186040 (MAPK1)
   04066 HIF-1 signaling pathway
    102186040 (MAPK1)
   04068 FoxO signaling pathway
    102186040 (MAPK1)
   04072 Phospholipase D signaling pathway
    102186040 (MAPK1)
   04071 Sphingolipid signaling pathway
    102186040 (MAPK1)
   04024 cAMP signaling pathway
    102186040 (MAPK1)
   04022 cGMP-PKG signaling pathway
    102186040 (MAPK1)
   04151 PI3K-Akt signaling pathway
    102186040 (MAPK1)
   04150 mTOR signaling pathway
    102186040 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102186040 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102186040 (MAPK1)
   04148 Efferocytosis
    102186040 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102186040 (MAPK1)
   04210 Apoptosis
    102186040 (MAPK1)
   04218 Cellular senescence
    102186040 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102186040 (MAPK1)
   04520 Adherens junction
    102186040 (MAPK1)
   04540 Gap junction
    102186040 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102186040 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102186040 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102186040 (MAPK1)
   04613 Neutrophil extracellular trap formation
    102186040 (MAPK1)
   04620 Toll-like receptor signaling pathway
    102186040 (MAPK1)
   04621 NOD-like receptor signaling pathway
    102186040 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    102186040 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    102186040 (MAPK1)
   04660 T cell receptor signaling pathway
    102186040 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    102186040 (MAPK1)
   04659 Th17 cell differentiation
    102186040 (MAPK1)
   04657 IL-17 signaling pathway
    102186040 (MAPK1)
   04662 B cell receptor signaling pathway
    102186040 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    102186040 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    102186040 (MAPK1)
   04062 Chemokine signaling pathway
    102186040 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102186040 (MAPK1)
   04929 GnRH secretion
    102186040 (MAPK1)
   04912 GnRH signaling pathway
    102186040 (MAPK1)
   04915 Estrogen signaling pathway
    102186040 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    102186040 (MAPK1)
   04917 Prolactin signaling pathway
    102186040 (MAPK1)
   04921 Oxytocin signaling pathway
    102186040 (MAPK1)
   04926 Relaxin signaling pathway
    102186040 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    102186040 (MAPK1)
   04919 Thyroid hormone signaling pathway
    102186040 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    102186040 (MAPK1)
   04916 Melanogenesis
    102186040 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102186040 (MAPK1)
   04270 Vascular smooth muscle contraction
    102186040 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102186040 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102186040 (MAPK1)
   04725 Cholinergic synapse
    102186040 (MAPK1)
   04726 Serotonergic synapse
    102186040 (MAPK1)
   04720 Long-term potentiation
    102186040 (MAPK1)
   04730 Long-term depression
    102186040 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    102186040 (MAPK1)
   04722 Neurotrophin signaling pathway
    102186040 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    102186040 (MAPK1)
   04380 Osteoclast differentiation
    102186040 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102186040 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102186040 (MAPK1)
   05206 MicroRNAs in cancer
    102186040 (MAPK1)
   05205 Proteoglycans in cancer
    102186040 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    102186040 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102186040 (MAPK1)
   05203 Viral carcinogenesis
    102186040 (MAPK1)
   05230 Central carbon metabolism in cancer
    102186040 (MAPK1)
   05231 Choline metabolism in cancer
    102186040 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102186040 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102186040 (MAPK1)
   05212 Pancreatic cancer
    102186040 (MAPK1)
   05225 Hepatocellular carcinoma
    102186040 (MAPK1)
   05226 Gastric cancer
    102186040 (MAPK1)
   05214 Glioma
    102186040 (MAPK1)
   05216 Thyroid cancer
    102186040 (MAPK1)
   05221 Acute myeloid leukemia
    102186040 (MAPK1)
   05220 Chronic myeloid leukemia
    102186040 (MAPK1)
   05218 Melanoma
    102186040 (MAPK1)
   05211 Renal cell carcinoma
    102186040 (MAPK1)
   05219 Bladder cancer
    102186040 (MAPK1)
   05215 Prostate cancer
    102186040 (MAPK1)
   05213 Endometrial cancer
    102186040 (MAPK1)
   05224 Breast cancer
    102186040 (MAPK1)
   05223 Non-small cell lung cancer
    102186040 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102186040 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    102186040 (MAPK1)
   05161 Hepatitis B
    102186040 (MAPK1)
   05160 Hepatitis C
    102186040 (MAPK1)
   05171 Coronavirus disease - COVID-19
    102186040 (MAPK1)
   05164 Influenza A
    102186040 (MAPK1)
   05163 Human cytomegalovirus infection
    102186040 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102186040 (MAPK1)
   05165 Human papillomavirus infection
    102186040 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102186040 (MAPK1)
   05135 Yersinia infection
    102186040 (MAPK1)
   05133 Pertussis
    102186040 (MAPK1)
   05152 Tuberculosis
    102186040 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102186040 (MAPK1)
   05140 Leishmaniasis
    102186040 (MAPK1)
   05142 Chagas disease
    102186040 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102186040 (MAPK1)
   05020 Prion disease
    102186040 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    102186040 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    102186040 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102186040 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102186040 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102186040 (MAPK1)
   04934 Cushing syndrome
    102186040 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102186040 (MAPK1)
   01524 Platinum drug resistance
    102186040 (MAPK1)
   01522 Endocrine resistance
    102186040 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102186040 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:chx03036]
    102186040 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102186040 (MAPK1)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102186040 (MAPK1)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102186040 (MAPK1)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102186040 (MAPK1)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102186040 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 102186040
NCBI-ProteinID: NP_001301131
UniProt: K7RCQ1
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaatctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttacgataatgtcaacaaagtccgagtcgccatcaagaaaatcagcccttttgag
caccagacgtactgccagaggacgctgagagagataaagatcttgctgcgcttcagacac
gagaacatcattggaatcaacgacattattcgggcgccgaccatcgagcagatgaaagac
gtatacatagtacaggacctcatggaaacagacctctacaagctcttgaagacgcaacac
ctcagcaacgaccacatctgctactttctctaccagatcctcagagggctgaagtatatc
cattcagccaacgtgctgcaccgggacctcaagccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcctggcccgtgttgcagatccggaccacgaccac
acagggttcctgaccgagtacgtggccacgcgctggtaccgggctccagagatcatgctg
aactccaagggctacaccaagtccatcgacatttggtccgtgggctgcatcctagcagag
atgctctccaacaggcccatcttccccgggaagcattacctcgaccagctgaaccacatt
ctgggtattcttggatctccgtcgcaggaagacctgaattgcataataaatttaaaagct
agaaactatctgctctctcttccacacaaaaataaggtgccgtggaacaggctgttcccg
aatgctgactccaaagctctggatttactggacaaaatgttgacgttcaaccctcacaag
aggatcgaggtggagcaggctctggcccacccgtacctggagcagtactacgatccaagc
gacgagcccgtcgccgaagcacccttcaagtttgacatggaattggatgacttgcccaag
gaaaagctcaaagaactcatttttgaagagactgctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system