Capra hircus (goat): 102187487 Help Entry 102187487         CDS       T02910                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism chx  Capra hircus (goat) Pathway chx04621   NOD-like receptor signaling pathway chx05012   Parkinson disease chx05132   Salmonella infection chx05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102187487 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102187487 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     102187487 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102187487 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:chx03110]     102187487 (TXN) Chaperones and folding catalysts [BR:chx03110]  Protein folding catalysts   Protein disulfide isomerase    102187487 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 AhpC-TSA OST3_OST6 Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  102187487 NCBI-ProteinID:  XP_005684347 UniProt:  A0A452EGP3 LinkDB All DBs Position 8:complement(99557654..99569691) Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVAAECEVKCMPTFQFFKKGQKVSEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagattgagagcaagtatgcttttcaggaagccttgaacagtgcaggagag aaactcgtagtagtcgacttctcagccacatggtgtgggccttgcaaaatgatcaagcct ttctttcattctctctctgaaaagtattccaacgtggtgttcctcgaagtagatgtggat gactgtcaggatgttgctgcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaaaggacagaaggtgagtgaattttctggagctaataaggaaaaacttgaagccacc attaatgaattaatctaa

DBGET integrated database retrieval system