Capra hircus (goat): 102188034 Help Entry 102188034         CDS       T02910                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04630   JAK-STAT signaling pathway chx04640   Hematopoietic cell lineage chx04657   IL-17 signaling pathway chx04658   Th1 and Th2 cell differentiation chx04660   T cell receptor signaling pathway chx04664   Fc epsilon RI signaling pathway chx04672   Intestinal immune network for IgA production chx05200   Pathways in cancer chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05330   Allograft rejection Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102188034 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102188034 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102188034 (IL5)    04660 T cell receptor signaling pathway     102188034 (IL5)    04658 Th1 and Th2 cell differentiation     102188034 (IL5)    04657 IL-17 signaling pathway     102188034 (IL5)    04664 Fc epsilon RI signaling pathway     102188034 (IL5)    04672 Intestinal immune network for IgA production     102188034 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102188034 (IL5)   09163 Immune disease    05310 Asthma     102188034 (IL5)    05320 Autoimmune thyroid disease     102188034 (IL5)    05321 Inflammatory bowel disease     102188034 (IL5)    05330 Allograft rejection     102188034 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102188034 (IL5)    00536 Glycosaminoglycan binding proteins [BR:chx00536]     102188034 (IL5) Cytokines and neuropeptides [BR:chx04052]  Cytokines   Interleukins    102188034 (IL5) Glycosaminoglycan binding proteins [BR:chx00536]  Heparan sulfate / Heparin   Cytokines    102188034 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  102188034 NCBI-ProteinID:  XP_005682676 LinkDB All DBs Position 7:complement(88684078..88686626) Genome browser AA seq 132 aa AA seqDB search MHLRLTLVALGAAYVCANAVESTMNRLVAETLTLLSTHQTLLIGDGNLMIPTPQHTNHQL CIEEVFQGIDTLKNQTAQGDAVKKIFRNLSLIKEYIDLQKRKCGGERWRVKQFLDYLQVF LGVINTEWTMES NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgcatctgcgtttgaccttggtagctcttggagctgcctatgtttgtgccaatgctgta gaaagtaccatgaatagactggtggcagagaccttgacactgctctccacgcatcaaact ctgctgataggtgatgggaacttgatgattcctactcctcagcatacaaatcaccaacta tgcattgaagaagtctttcagggaatagacacgttgaagaatcaaactgcacaaggggat gctgtgaaaaaaatattccgaaacttgtctttaataaaagaatacatagacctccaaaaa aggaagtgtggaggagaaagatggagagtgaaacaattcctcgactacctgcaagttttc cttggtgtgataaacacagagtggacgatggaaagctga

DBGET integrated database retrieval system