Capra hircus (goat): 102188072 Help Entry 102188072         CDS       T02910                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism chx  Capra hircus (goat) Pathway chx04978   Mineral absorption Brite KEGG Orthology (KO) [BR:chx00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     102188072  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:chx03019]     102188072    03029 Mitochondrial biogenesis [BR:chx03029]     102188072 Messenger RNA biogenesis [BR:chx03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      102188072 Mitochondrial biogenesis [BR:chx03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     102188072 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  102188072 NCBI-ProteinID:  XP_005692056 LinkDB All DBs Position 18:complement(25412231..25413442) Genome browser AA seq 61 aa AA seqDB search MDPNCSCTAGESCTCAGSCKCKDCKCASCKKSCCSCCPVGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcctgcaccgcgggtgaatcctgcacgtgtgccggctcctgcaaa tgcaaagattgcaagtgcgcctcctgcaagaagagctgctgctcctgctgccccgtgggc tgtgccaagtgtgcccagggctgcgtctgcaaaggggcctcggacaagtgcagttgctgt gcctga

DBGET integrated database retrieval system