KEGG   Capra hircus (goat): 102188824
Entry
102188824         CDS       T02910                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04140  Autophagy - animal
chx04148  Efferocytosis
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04218  Cellular senescence
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04350  TGF-beta signaling pathway
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04371  Apelin signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04517  IgSF CAM signaling
chx04520  Adherens junction
chx04540  Gap junction
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04722  Neurotrophin signaling pathway
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04730  Long-term depression
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04926  Relaxin signaling pathway
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04930  Type II diabetes mellitus
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx05010  Alzheimer disease
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05034  Alcoholism
chx05132  Salmonella infection
chx05133  Pertussis
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05207  Chemical carcinogenesis - receptor activation
chx05208  Chemical carcinogenesis - reactive oxygen species
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05218  Melanoma
chx05219  Bladder cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102188824 (MAPK3)
   04012 ErbB signaling pathway
    102188824 (MAPK3)
   04014 Ras signaling pathway
    102188824 (MAPK3)
   04015 Rap1 signaling pathway
    102188824 (MAPK3)
   04350 TGF-beta signaling pathway
    102188824 (MAPK3)
   04370 VEGF signaling pathway
    102188824 (MAPK3)
   04371 Apelin signaling pathway
    102188824 (MAPK3)
   04668 TNF signaling pathway
    102188824 (MAPK3)
   04066 HIF-1 signaling pathway
    102188824 (MAPK3)
   04068 FoxO signaling pathway
    102188824 (MAPK3)
   04072 Phospholipase D signaling pathway
    102188824 (MAPK3)
   04071 Sphingolipid signaling pathway
    102188824 (MAPK3)
   04024 cAMP signaling pathway
    102188824 (MAPK3)
   04022 cGMP-PKG signaling pathway
    102188824 (MAPK3)
   04151 PI3K-Akt signaling pathway
    102188824 (MAPK3)
   04150 mTOR signaling pathway
    102188824 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102188824 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102188824 (MAPK3)
   04148 Efferocytosis
    102188824 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102188824 (MAPK3)
   04210 Apoptosis
    102188824 (MAPK3)
   04218 Cellular senescence
    102188824 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102188824 (MAPK3)
   04520 Adherens junction
    102188824 (MAPK3)
   04540 Gap junction
    102188824 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102188824 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102188824 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102188824 (MAPK3)
   04613 Neutrophil extracellular trap formation
    102188824 (MAPK3)
   04620 Toll-like receptor signaling pathway
    102188824 (MAPK3)
   04621 NOD-like receptor signaling pathway
    102188824 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    102188824 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    102188824 (MAPK3)
   04660 T cell receptor signaling pathway
    102188824 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    102188824 (MAPK3)
   04659 Th17 cell differentiation
    102188824 (MAPK3)
   04657 IL-17 signaling pathway
    102188824 (MAPK3)
   04662 B cell receptor signaling pathway
    102188824 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    102188824 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    102188824 (MAPK3)
   04062 Chemokine signaling pathway
    102188824 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102188824 (MAPK3)
   04929 GnRH secretion
    102188824 (MAPK3)
   04912 GnRH signaling pathway
    102188824 (MAPK3)
   04915 Estrogen signaling pathway
    102188824 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    102188824 (MAPK3)
   04917 Prolactin signaling pathway
    102188824 (MAPK3)
   04921 Oxytocin signaling pathway
    102188824 (MAPK3)
   04926 Relaxin signaling pathway
    102188824 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    102188824 (MAPK3)
   04919 Thyroid hormone signaling pathway
    102188824 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    102188824 (MAPK3)
   04916 Melanogenesis
    102188824 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102188824 (MAPK3)
   04270 Vascular smooth muscle contraction
    102188824 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102188824 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102188824 (MAPK3)
   04725 Cholinergic synapse
    102188824 (MAPK3)
   04726 Serotonergic synapse
    102188824 (MAPK3)
   04720 Long-term potentiation
    102188824 (MAPK3)
   04730 Long-term depression
    102188824 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    102188824 (MAPK3)
   04722 Neurotrophin signaling pathway
    102188824 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    102188824 (MAPK3)
   04380 Osteoclast differentiation
    102188824 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102188824 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102188824 (MAPK3)
   05206 MicroRNAs in cancer
    102188824 (MAPK3)
   05205 Proteoglycans in cancer
    102188824 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    102188824 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    102188824 (MAPK3)
   05203 Viral carcinogenesis
    102188824 (MAPK3)
   05230 Central carbon metabolism in cancer
    102188824 (MAPK3)
   05231 Choline metabolism in cancer
    102188824 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102188824 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102188824 (MAPK3)
   05212 Pancreatic cancer
    102188824 (MAPK3)
   05225 Hepatocellular carcinoma
    102188824 (MAPK3)
   05226 Gastric cancer
    102188824 (MAPK3)
   05214 Glioma
    102188824 (MAPK3)
   05216 Thyroid cancer
    102188824 (MAPK3)
   05221 Acute myeloid leukemia
    102188824 (MAPK3)
   05220 Chronic myeloid leukemia
    102188824 (MAPK3)
   05218 Melanoma
    102188824 (MAPK3)
   05211 Renal cell carcinoma
    102188824 (MAPK3)
   05219 Bladder cancer
    102188824 (MAPK3)
   05215 Prostate cancer
    102188824 (MAPK3)
   05213 Endometrial cancer
    102188824 (MAPK3)
   05224 Breast cancer
    102188824 (MAPK3)
   05223 Non-small cell lung cancer
    102188824 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102188824 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    102188824 (MAPK3)
   05161 Hepatitis B
    102188824 (MAPK3)
   05160 Hepatitis C
    102188824 (MAPK3)
   05171 Coronavirus disease - COVID-19
    102188824 (MAPK3)
   05164 Influenza A
    102188824 (MAPK3)
   05163 Human cytomegalovirus infection
    102188824 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102188824 (MAPK3)
   05165 Human papillomavirus infection
    102188824 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102188824 (MAPK3)
   05135 Yersinia infection
    102188824 (MAPK3)
   05133 Pertussis
    102188824 (MAPK3)
   05152 Tuberculosis
    102188824 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102188824 (MAPK3)
   05140 Leishmaniasis
    102188824 (MAPK3)
   05142 Chagas disease
    102188824 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102188824 (MAPK3)
   05020 Prion disease
    102188824 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    102188824 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    102188824 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102188824 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102188824 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102188824 (MAPK3)
   04934 Cushing syndrome
    102188824 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102188824 (MAPK3)
   01524 Platinum drug resistance
    102188824 (MAPK3)
   01522 Endocrine resistance
    102188824 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102188824 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:chx03036]
    102188824 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102188824 (MAPK3)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102188824 (MAPK3)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102188824 (MAPK3)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102188824 (MAPK3)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102188824 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 102188824
NCBI-ProteinID: XP_017896269
UniProt: A0A452EU65
LinkDB
Position
25:26089022..26095888
AA seq 380 aa
MAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGVLEAS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggaactgatggg
gtcggcccgggggtcccgggggaggtggagatagtaaaggggcagccgttcgacgtgggc
ccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct
tacgaccatgtgcgcaagactcgagtggccatcaagaagatcagcccctttgagcatcag
acctactgccagcgcacgttgcgagagattcagattctgctgcgcttccgccatgagaac
gtcattggtatccgagacattctgcgagcacccaccctggaagccatgagggatgtctac
atcgtgcaggacctgatggagacagacctgtacaaattgctcaaaagccagcagctgagc
aacgaccatgtatgctacttcctgtaccagatcctgcggggcctgaagtatatccactcc
gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatctgtgatttcggtcttgcccggattgctgatcccgagcatgaccacactggc
ttcttgacggaatatgtggccacacgctggtaccgggccccagagatcatgcttaactcc
aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctgggt
attctgggctccccatcccaggaggacctgaactgtatcatcaacatgaaagcccgaaac
tacctgcagtctctgccctccaagaccaaggtggcctgggccaagctttttcctaagtca
gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc
acagtggaagaagcgctggctcacccctacctggagcagtactatgacccaacggatgag
ccagtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggaacga
ctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctggaggcctcc
taa

DBGET integrated database retrieval system