KEGG   Capra hircus (goat): 102189919
Entry
102189919         CDS       T02910                                 
Symbol
TOMM40L
Name
(RefSeq) mitochondrial import receptor subunit TOM40B
  KO
K11518  mitochondrial import receptor subunit TOM40
Organism
chx  Capra hircus (goat)
Pathway
chx04137  Mitophagy - animal
chx05014  Amyotrophic lateral sclerosis
chx05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102189919 (TOMM40L)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102189919 (TOMM40L)
   05022 Pathways of neurodegeneration - multiple diseases
    102189919 (TOMM40L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:chx03029]
    102189919 (TOMM40L)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:chx02000]
    102189919 (TOMM40L)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    102189919 (TOMM40L)
Transporters [BR:chx02000]
 Other transporters
  Primary active transporters [TC:3]
   102189919 (TOMM40L)
SSDB
Motif
Pfam: Porin_3 CBP_BcsS
Other DBs
NCBI-GeneID: 102189919
NCBI-ProteinID: XP_005677216
UniProt: A0A452F2K4
LinkDB
Position
3:111841452..111845962
AA seq 308 aa
MGNTLGLAPMGALPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHF
QVAHTVHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLR
AKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPDLIGESVIMVAHFLQSLTHRLVLGG
ELVYHRRPGEEGAILTLAGKYSAVHWVATLNVGSGGAHASYYHRANEQVQVGVEFEANTR
LQDTTFSFGYHLTLPQANMVFRGLVDSNWCVGAVLEKKMPPLPVTLALGAFLNHWRNRFH
CGFSITVG
NT seq 927 nt   +upstreamnt  +downstreamnt
atggggaacacactaggcctggcacctatgggggctttgccccgccggagcccccgtcga
gaggaacctctccccaaccctgggagctttgatgagctgcaccggctatgcaaagatgta
ttcccagcacagatggagggagtgaagctcgttgtcaacaaggttctgagcagccatttc
caggtggctcacactgtgcacatgagtgctctgggtttgccaggctatcatcttcatgcg
gcctatgcaggggactggcaacttagtcccactgaggtgttccccactgtggtgggagat
atggacagcagcggcagcctcaacgcccaggtcctgctcctcttggcagagcggctccga
gccaaggctgtctttcagacgcagcaggccaagttcctgacctggcagtttgatggcgag
tatcggggagatgactacacagccactctgaccctaggaaatccggacctcattggggaa
tcagtgatcatggtcgctcacttcctgcagagcctcacgcatcgactggtgctgggagga
gagctagtttatcaccggcggccaggcgaagagggggccatcctgacactggctgggaag
tactcggctgtccactgggtagctacattgaatgtgggatcaggtggggcccatgcaagt
tattaccacagggcaaatgagcaggttcaggttggagtggagtttgaagcaaacacaagg
ctacaagacacaaccttctcctttggttaccacctgactctgccccaggccaacatggta
tttagaggcttggtggatagtaactggtgtgtgggtgctgtgctggagaagaagatgccc
cccctgcctgtcaccctcgccctcggagccttccttaatcactggcgcaacagattccac
tgtggctttagcatcactgtgggctga

DBGET integrated database retrieval system