Capra hircus (goat): 102190507 Help Entry 102190507         CDS       T02910                                  Name (RefSeq) interleukin-3 isoform X2   KO K04736   interleukin 3 Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04210   Apoptosis chx04630   JAK-STAT signaling pathway chx04640   Hematopoietic cell lineage chx04664   Fc epsilon RI signaling pathway chx05200   Pathways in cancer chx05202   Transcriptional misregulation in cancer chx05221   Acute myeloid leukemia chx05310   Asthma Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102190507    04151 PI3K-Akt signaling pathway     102190507   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102190507  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102190507  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102190507    04664 Fc epsilon RI signaling pathway     102190507  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102190507    05202 Transcriptional misregulation in cancer     102190507   09162 Cancer: specific types    05221 Acute myeloid leukemia     102190507   09163 Immune disease    05310 Asthma     102190507  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102190507    00536 Glycosaminoglycan binding proteins [BR:chx00536]     102190507 Cytokines and neuropeptides [BR:chx04052]  Cytokines   Interleukins    102190507 Glycosaminoglycan binding proteins [BR:chx00536]  Heparan sulfate / Heparin   Cytokines    102190507 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL3 Motif Other DBs NCBI-GeneID:  102190507 NCBI-ProteinID:  XP_005682685 LinkDB All DBs Position 7:88148538..88150765 Genome browser AA seq 139 aa AA seqDB search MSSLSILHLLLLLLALHAPQAQGLPLRTSRTPYSSLMEEIMDDLKKITPSPEGSLNSDEK NILANKSLLQANLKAFMTFATDTFGNDSKIMKNLKEFQPVLPTATPTEDSILIEDSNLGD FRMKLEEYLATIRGYLRHD NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgagcagcctctctatcttgcatctgctcctgctcctgcttgcactccatgcccctcag gcacaggggctgcctttgaggacatcgaggactccatattctagcttgatggaggaaatt atggatgacctaaagaaaataactccgagtccagaaggctccttgaactcagatgagaag aatatcctggcgaataagagccttctgcaggcaaacctgaaagcgttcatgacatttgcc acagatacttttggaaatgattcaaaaatcatgaaaaatcttaaggaattccagccagtg ctgcccacagccacacccacggaagattcaattcttattgaggacagcaacttgggggat tttcggatgaaattggaagaatatttggctaccattagaggctatctcagacacgactga

DBGET integrated database retrieval system