Capra hircus (goat): 102190519 Help Entry 102190519         CDS       T02910                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism chx  Capra hircus (goat) Pathway chx04068   FoxO signaling pathway chx04136   Autophagy - other chx04140   Autophagy - animal chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     102190519 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102190519 (ATG12)    04136 Autophagy - other     102190519 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102190519 (ATG12)    04622 RIG-I-like receptor signaling pathway     102190519 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:chx04131]     102190519 (ATG12)    04121 Ubiquitin system [BR:chx04121]     102190519 (ATG12)    03029 Mitochondrial biogenesis [BR:chx03029]     102190519 (ATG12) Membrane trafficking [BR:chx04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     102190519 (ATG12) Ubiquitin system [BR:chx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    102190519 (ATG12) Mitochondrial biogenesis [BR:chx03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     102190519 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  102190519 NCBI-ProteinID:  XP_005685101 UniProt:  A0A452FY60 LinkDB All DBs Position 10:96522785..96543126 Genome browser AA seq 140 aa AA seqDB search MAEEQESALLLPPSAAPEAEVPAEVSPETATPEPPSSAAVSPGTEEPVGDTKKKIDILLK AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY ECFGSDGKLVLHYCKSQAWG NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctgaggagcaagagtctgcgctgctgctccctccctcagctgctcccgaagctgaa gtgcctgccgaggtctccccagaaacagccactccggagcccccttcttctgctgcagtc tctccgggaacagaggaacctgtcggtgacaccaagaaaaaaattgacattctgctaaag gctgtgggagacactcctataatgaaaacaaagaaatgggctgtggagcgaacccgaacc atccaaggactcattgacttcatcaaaaagttccttaaacttgtggcttcggaacagttg tttatttacgtgaatcagtcctttgccccctccccagaccaggaagttgggaccctctat gagtgttttggcagtgatggtaaactggtcctgcattactgcaaatctcaagcatgggga tga

DBGET integrated database retrieval system