KEGG   Capra hircus (goat): 102191015
Entry
102191015         CDS       T02910                                 
Symbol
PSMC2
Name
(RefSeq) 26S protease regulatory subunit 7
  KO
K03061  26S proteasome regulatory subunit T1
Organism
chx  Capra hircus (goat)
Pathway
chx03050  Proteasome
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    102191015 (PSMC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102191015 (PSMC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102191015 (PSMC2)
   05012 Parkinson disease
    102191015 (PSMC2)
   05014 Amyotrophic lateral sclerosis
    102191015 (PSMC2)
   05016 Huntington disease
    102191015 (PSMC2)
   05017 Spinocerebellar ataxia
    102191015 (PSMC2)
   05020 Prion disease
    102191015 (PSMC2)
   05022 Pathways of neurodegeneration - multiple diseases
    102191015 (PSMC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:chx03051]
    102191015 (PSMC2)
Proteasome [BR:chx03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     102191015 (PSMC2)
SSDB
Motif
Pfam: AAA PRS7_OB AAA_lid_3 AAA_22 AAA_2 AAA_5 AAA_16 DUF815 nSTAND3 RuvB_N AAA_28 AAA_7 AAA_14 Prot_ATP_ID_OB_C AAA_33 AAA_18 TIP49 Sigma54_activ_2 Mg_chelatase RNA_helicase AAA_24 IstB_IS21
Other DBs
NCBI-GeneID: 102191015
NCBI-ProteinID: XP_005679166
UniProt: A0A452ER37
LinkDB
Position
4:complement(75722053..75736401)
AA seq 433 aa
MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgcctgattacctcggtgctgatcagaggaaaactaaagaagatgagaaggacgacaag
cccatccgagcgctggatgaaggggatattgccttgctgaaaacttacggtcagagcact
tactctaggcagatcaaacaggttgaagatgacattcaacaacttctcaagaaaattaat
gagctcaccggtattaaagagtctgacactggcctggccccaccagcactctgggatttg
gctgcggataagcaaacactccagagcgaacagcctttgcaggttgcaagatgcacaaag
ataatcaatgctgactcagaggacccgaagtacatcatcaatgtgaagcagtttgccaag
tttgtggtggacctcagtgatcaggtagcacctaccgacattgaagaagggatgagagtt
ggtgtggacagaaataagtaccagattcacatcccattgcctcctaagatcgacccaaca
gtcaccatgatgcaggtggaggaaaaacctgatgttacatacagtgatgtgggtggctgt
aaggaacagattgagaaacttcgagaagtagttgagaccccactgcttcatccagagagg
tttgtcaaccttggcattgagcctcccaagggtgtgctgctctttggtccaccgggtacc
ggcaagacactctgcgctcgggcagttgctaataggactgatgcttgcttcattcgagtt
attggatctgaacttgtacagaagtatgttggtgagggggctcgaatggttcgagagctc
tttgaaatggccagaacaaagaaagcctgccttatcttttttgatgaaattgatgctatt
ggaggggctcgttttgacgatggtgctgggggtgacaatgaagtgcagaggaccatgttg
gaactgatcaatcagctggatgggtttgatcctcgaggcaacattaaagtgctcatggct
acaaacagacctgacactctggacccagcgctcatgaggccggggagactggacagaaag
attgagtttagcttacctgatctagagggtcggactcacatttttaagattcatgcccgt
tcaatgagtgttgaaagagatatcagatttgaattgttagcacgactgtgtccaaatagc
actggtgctgagatcagaagcgtctgcacagaagctggtatgtttgccatccgagcacgg
cgaaaaattgctactgagaaggatttcttggaagctgtaaataaggtcattaagtcctac
gccaagttcagtgctactccccgctatatgacatacaactga

DBGET integrated database retrieval system