KEGG   Capra hircus (goat): 102191724
Entry
102191724         CDS       T02910                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102191724 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:chx04050]
    102191724 (TNFRSF8)
   04090 CD molecules [BR:chx04090]
    102191724 (TNFRSF8)
Cytokine receptors [BR:chx04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102191724 (TNFRSF8)
CD molecules [BR:chx04090]
 Proteins
  102191724 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 102191724
NCBI-ProteinID: XP_017915432
LinkDB
Position
16:complement(40049635..40096376)
AA seq 486 aa
MFCGTSVVNSCARCIPHSVCPAGMVVKLQGTTQRDTVCEPASPRASPNCSTSPQDCKGPT
SGAIPQAKPTLTSPESPGARTMLLGGDIPLTPEDASKMTPNSSSFVVKLNPDPGLTLQPP
CPWGSADCRKQCNHDYYLDRDGRCKACVTCSGDGLVEKTPCTWNSSRVCECQPGMFCATP
VTNSCARCVTRPNCPPGMVTKLQGMAETGTTYEPPGLGSPPDCNTSPEDRGAPTSPTPSL
VSLADSLTGKEHEAGVTHTWEDTLVSTSAPISFSSTGKPALVSGPVLFWVILILAVVVSF
SSFVLCHQRACRKWIGQKLHLCYPVQTFRPTLEPVDSKPGRNPILTKSVSVADPGNEEQG
LLSRPAVETCLESLRLLEANPVSSPPSPTDLPEPRGTTEHTNNRIENIYIMKADTVIVGT
VKAEVPEGQGPMGPARPELEEELEMDYASHYPEQETEPPLGSCGDVMFSVEEEGKEDPLP
TTVSEK
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgttctgtggcacgtcagtcgtcaattcctgtgcccgctgcatcccccactctgtctgc
ccggcaggaatggttgtcaagttgcagggcacaacacagagggacaccgtctgtgaacca
gcttctccaagggccagccccaactgcagcaccagcccacaggactgcaagggccccacc
agtggcgccatcccccaggccaagcccaccctgacctccccagaaagccctggtgccagg
accatgcttctcggaggggacatccccctcaccccagaagatgcttctaaaatgactccc
aactccagctccttcgtggtgaagctcaatccagatccagggctgaccctgcagcccccg
tgcccttgggggtctgctgactgcaggaagcagtgtaaccacgactactacctggacagg
gacggtcgctgcaaggcctgtgtgacatgttcaggagatggcctcgtggagaagacacct
tgcacatggaactcttcccgagtctgtgagtgtcaacctggcatgttctgtgccacgcca
gtcaccaattcctgtgcccgctgcgtcacccgccccaactgcccaccagggatggtcacc
aagctccagggtatggctgagacaggcaccacctatgagccacctggactggggagccct
cctgactgcaacaccagcccagaggaccgtggggcgcctaccagccccaccccctccttg
gtctccctggctgactccctgaccggtaaggagcatgaagcgggtgtcacccacacctgg
gaggacaccctggtctcaaccagtgctcccatctccttctcctccacgggaaagccggct
ctggtttcaggacctgtgctcttctgggtgattctgatactggcggtggtcgtcagcttc
agctccttcgtcctgtgccaccagagggcctgcaggaagtggattggacagaagctgcat
ctgtgctacccagtccagaccttccggcccacgctggagcctgtggattccaagccaggg
aggaacccgatactgaccaagagtgtatcagtggcagacccaggcaatgaggagcagggc
ttactgagtcgcccggctgtggagacctgcctggagagcctgcggctgctggaggccaac
ccagtcagcagccccccgtcccccacagacctacctgagccccgagggaccacggagcat
accaacaacaggattgagaacatctacatcatgaaagccgacaccgtgattgtggggacc
gtgaaggccgaggtgcctgagggccaaggcccaatggggccagccaggcccgagctcgag
gaggagctggagatggactatgcctcccactacccggagcaggagacagagccaccgctg
ggcagctgtggggacgttatgttctcagtggaggaggaagggaaggaggaccccttgccc
acgactgtctctgagaaatga

DBGET integrated database retrieval system