Capra hircus (goat): 106503499 Help Entry 106503499         CDS       T02910                                  Name (RefSeq) histone H3.1-like   KO K11253   histone H3 Organism chx  Capra hircus (goat) Pathway chx04613   Neutrophil extracellular trap formation chx05034   Alcoholism chx05202   Transcriptional misregulation in cancer chx05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:chx00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106503499  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     106503499   09163 Immune disease    05322 Systemic lupus erythematosus     106503499   09165 Substance dependence    05034 Alcoholism     106503499  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     106503499   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     106503499 Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106503499 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106503499 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  106503499 NCBI-ProteinID:  XP_017894004 UniProt:  A0A452E3I1 LinkDB All DBs Position 23:18226747..18227630 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRVRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcactaagcagaccgctcgcaagtccaccggcggtaaggcgccgcgcaagcag ctcgccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtgaagaagccccac cgctaccggcccggcacggtagctctgcgagagatccgccgctaccagaagtccacggag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcacaggacttcaag accgacctgcgcttccaaagctcggcggtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatt atgcccaaggacatccagcttgcacgccgggtccgcggagagagggcataa

DBGET integrated database retrieval system