Capra hircus (goat): 106503502 Help Entry 106503502         CDS       T02910                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism chx  Capra hircus (goat) Pathway chx04613   Neutrophil extracellular trap formation chx05034   Alcoholism chx05203   Viral carcinogenesis chx05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:chx00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106503502  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     106503502   09163 Immune disease    05322 Systemic lupus erythematosus     106503502   09165 Substance dependence    05034 Alcoholism     106503502  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     106503502 Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106503502 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  106503502 NCBI-ProteinID:  XP_013829533 UniProt:  A0A452DWU1 LinkDB All DBs Position 23:complement(18078566..18080068) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggtaaaggcggcaaaggccttgggaaaggaggcgctaagcgccaccgc aaggttctgcgcgacaatatccagggtatcaccaaacccgccattcgtcgcctggctcgt cgtggtggtgtgaagcgcatctccgggctcatctacgaggagacccgtggggtgctgaag gtatttctggaaaatgtaatccgggacgcggtcacctacaccgagcacgccaaacgcaag actgtcaccgccatggacgtggtctacgcgctcaaacgccagggccgcaccctctatggt ttcggcggctaa

DBGET integrated database retrieval system