Capra hircus (goat): 108633554 Help Entry 108633554         CDS       T02910                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism chx  Capra hircus (goat) Pathway chx04613   Neutrophil extracellular trap formation chx05034   Alcoholism chx05202   Transcriptional misregulation in cancer chx05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:chx00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     108633554  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     108633554   09163 Immune disease    05322 Systemic lupus erythematosus     108633554   09165 Substance dependence    05034 Alcoholism     108633554  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     108633554   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     108633554 Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108633554 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108633554 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  108633554 NCBI-ProteinID:  XP_017894801 UniProt:  A0A452DQD8 LinkDB All DBs Position 23:26661859..26662304 Genome browser AA seq 136 aa AA seqDB search MARTKQTAGKLTGGKALRKQLATKAARKSAPSTGGVKKPHHYRPGTVALREIRRYQKSTE LLIRELPFQRLVREIAQDFKTDLCFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLACRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgccggcaaattgactggtggtaaagcactgaggaagcaa ctcgctacaaaagctgctcgcaagagtgcaccctctactggaggggtgaagaaacctcat cattacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcgaacttcccttccagcgtctggtgcgggaaattgctcaggacttcaaa acagatctgtgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcatgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system