Capra hircus (goat): 108633784 Help Entry 108633784         CDS       T02910                                  Name (RefSeq) gastrin-like   KO K13768   gastrin Organism chx  Capra hircus (goat) Pathway chx04081   Hormone signaling chx04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     108633784  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     108633784  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     108633784 Cytokines and neuropeptides [BR:chx04052]  Neuropeptides   GPCR binding    108633784 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  108633784 NCBI-ProteinID:  XP_017894875 UniProt:  A0A452DTU8 LinkDB All DBs Position 24:complement(26860762..26861101) Genome browser AA seq 104 aa AA seqDB search MQRLCAHALILVLALAAFCEASWKPHSPLQDAPVAPGANKGQEPLRMDRRGPASHPRRQL GLQDPPHMVADLSKKQGPWVEEEEAAYGWMDFGLRSAEEGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcacatgcgctgatcttggtgctggctctggccgccttctgcgaa gcttcttggaaaccccactccccactgcaagatgcgcccgtcgctccaggggccaataag ggccaggagcctctcaggatggaccggcggggcccagcctcgcacccccgccggcagctg gggcttcaggatccgccacacatggtcgcagacctgtccaagaagcaggggccgtgggtg gaggaagaggaagccgcatatggatggatggacttcggcctccgcagtgctgaggaaggg gaccaacatccctga

DBGET integrated database retrieval system