Capra hircus (goat): 108634241 Help Entry 108634241         CDS       T02910                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism chx  Capra hircus (goat) Pathway chx04010   MAPK signaling pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04022   cGMP-PKG signaling pathway chx04066   HIF-1 signaling pathway chx04068   FoxO signaling pathway chx04072   Phospholipase D signaling pathway chx04081   Hormone signaling chx04114   Oocyte meiosis chx04140   Autophagy - animal chx04150   mTOR signaling pathway chx04151   PI3K-Akt signaling pathway chx04152   AMPK signaling pathway chx04211   Longevity regulating pathway chx04213   Longevity regulating pathway - multiple species chx04810   Regulation of actin cytoskeleton chx04910   Insulin signaling pathway chx04911   Insulin secretion chx04913   Ovarian steroidogenesis chx04914   Progesterone-mediated oocyte maturation chx04917   Prolactin signaling pathway chx04923   Regulation of lipolysis in adipocytes chx04930   Type II diabetes mellitus chx04931   Insulin resistance chx04932   Non-alcoholic fatty liver disease chx04940   Type I diabetes mellitus chx04950   Maturity onset diabetes of the young chx04960   Aldosterone-regulated sodium reabsorption chx05010   Alzheimer disease chx05215   Prostate cancer chx05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108634241 (INS)    04014 Ras signaling pathway     108634241 (INS)    04015 Rap1 signaling pathway     108634241 (INS)    04066 HIF-1 signaling pathway     108634241 (INS)    04068 FoxO signaling pathway     108634241 (INS)    04072 Phospholipase D signaling pathway     108634241 (INS)    04022 cGMP-PKG signaling pathway     108634241 (INS)    04151 PI3K-Akt signaling pathway     108634241 (INS)    04152 AMPK signaling pathway     108634241 (INS)    04150 mTOR signaling pathway     108634241 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     108634241 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108634241 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     108634241 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     108634241 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     108634241 (INS)    04910 Insulin signaling pathway     108634241 (INS)    04923 Regulation of lipolysis in adipocytes     108634241 (INS)    04913 Ovarian steroidogenesis     108634241 (INS)    04914 Progesterone-mediated oocyte maturation     108634241 (INS)    04917 Prolactin signaling pathway     108634241 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     108634241 (INS)   09149 Aging    04211 Longevity regulating pathway     108634241 (INS)    04213 Longevity regulating pathway - multiple species     108634241 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     108634241 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     108634241 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     108634241 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     108634241 (INS)    04940 Type I diabetes mellitus     108634241 (INS)    04950 Maturity onset diabetes of the young     108634241 (INS)    04932 Non-alcoholic fatty liver disease     108634241 (INS)    04931 Insulin resistance     108634241 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     108634241 (INS) Cytokines and neuropeptides [BR:chx04052]  Neuropeptides   Unclassified    108634241 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  108634241 NCBI-ProteinID:  XP_017898972 UniProt:  A0A452E6C9 LinkDB All DBs Position 29:50411481..50412858 Genome browser AA seq 105 aa AA seqDB search MALWTRLVPLLALLALWAPAPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG PQVGVLELAGGPGAGSLEGPPQKRGIVEQCCAGVCSLYQLENYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacacgcctggtgcccctgctggccctgctggcgctctgggcccccgcc ccggcccgcgccttcgtcaaccagcacctgtgcggctcccacctggtggaggcgctgtac ctggtttgcggagagcgcggcttcttctacacgcccaaggcccgccgggaggtggagggc ccccaggtgggggtgctggagctggccggaggccctggcgcgggcagcctggaggggccc ccccagaagcgtggcatcgtggagcagtgctgtgccggcgtctgctctctctaccagctg gagaattactgcaactag

DBGET integrated database retrieval system