Capra hircus (goat): 108634443 Help Entry 108634443         CDS       T02910                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism chx  Capra hircus (goat) Pathway chx04613   Neutrophil extracellular trap formation chx05034   Alcoholism chx05203   Viral carcinogenesis chx05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:chx00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     108634443  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     108634443   09163 Immune disease    05322 Systemic lupus erythematosus     108634443   09165 Substance dependence    05034 Alcoholism     108634443  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     108634443   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     108634443 Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108634443 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108634443 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF CENP-T_C DUF1931 Motif Other DBs NCBI-GeneID:  108634443 NCBI-ProteinID:  XP_017899596 LinkDB All DBs Position X Genome browser AA seq 155 aa AA seqDB search MENGGAAVWKPSSDSHEEDVITIDTSTSETEPSETEMAKAETSKPEPCDAEPRKAKQKTA KGRRCPSPPLPSGVLKQVHTGLSLSRESVNVLDSFVKDMFERIAEEAGRLAHSNKRCTIM TEDIQTSVRLLLPGELGKYATSEATKSVIRYHLCR NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggagaatggtggcgctgccgtgtggaaaccgtcctctgacagccatgaggaagacgtg atcaccatagacaccagcacgtctgaaactgagccctctgaaacggagatggcgaaagca gagacctccaaaccagagccgtgtgatgcggaaccaagaaaggcgaagcagaagacagct aagggccgccgttgcccgtcgccgccgctgccgtcaggggtgctgaagcaagtacataca ggcctgagtctttcccgtgagtccgtgaacgtcctggattcgtttgtgaaagatatgttc gagcggattgccgaagaggccgggcgcctggcccacagcaacaagcgctgcaccatcatg accgaagacatccagacatctgtgcgtcttctgttgcctggggagctcggcaagtatgcc acgtccgaggccaccaagtcggtcatcagataccacctctgcagatga

DBGET integrated database retrieval system