Capra hircus (goat): 108638246 Help Entry 108638246         CDS       T02910                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04061   Viral protein interaction with cytokine and cytokine receptor chx04062   Chemokine signaling pathway chx04620   Toll-like receptor signaling pathway chx05142   Chagas disease chx05163   Human cytomegalovirus infection chx05323   Rheumatoid arthritis chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108638246    04061 Viral protein interaction with cytokine and cytokine receptor     108638246  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108638246    04062 Chemokine signaling pathway     108638246  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     108638246   09174 Infectious disease: parasitic    05142 Chagas disease     108638246   09163 Immune disease    05323 Rheumatoid arthritis     108638246   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108638246  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     108638246    00536 Glycosaminoglycan binding proteins [BR:chx00536]     108638246 Cytokines and neuropeptides [BR:chx04052]  Cytokines   Chemokines    108638246 Glycosaminoglycan binding proteins [BR:chx00536]  Heparan sulfate / Heparin   Chemokines    108638246 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Cas12f1-like_TNB Motif Other DBs NCBI-GeneID:  108638246 NCBI-ProteinID:  XP_017919705 UniProt:  A0A452DQ36 LinkDB All DBs Position 19:complement(14030589..14032658) Genome browser AA seq 93 aa AA seqDB search MEVPGAALAVLLLTAALSAHTCSATLGANTPTACCFSFVSRQIPRKFVDDYYETSSQCSK PGVIFKTKRGRQVCADPSEDWVQEYITDLELNP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaggtccccggggccgccctggctgtcctgctgctcaccgcggccctctctgcccac acctgctctgccacccttggtgccaacaccccgaccgcctgctgcttctccttcgtctcc cggcagatcccgcgcaaattcgtggatgactattacgagaccagcagccagtgctccaag cccggagtcatcttcaagaccaaaagaggccggcaggtctgtgccgaccccagtgaggac tgggtccaggaatacatcactgacctggagctgaatccctga

DBGET integrated database retrieval system