Carboxydothermus hydrogenoformans: CHY_0806 Help Entry CHY_0806          CDS       T00287                                  Symbol groES Name (GenBank) chaperonin, 10 kDa   KO K04078   chaperonin GroES Organism chy  Carboxydothermus hydrogenoformans Brite KEGG Orthology (KO) [BR:chy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:chy03110]     CHY_0806 (groES)    03029 Mitochondrial biogenesis [BR:chy03029]     CHY_0806 (groES) Chaperones and folding catalysts [BR:chy03110]  Heat shock proteins   HSP10    CHY_0806 (groES) Mitochondrial biogenesis [BR:chy03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     CHY_0806 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  ABB15524 UniProt:  Q3ADX4 LinkDB All DBs Position 714494..714778 Genome browser AA seq 94 aa AA seqDB search MFRPLHDRVLVKPLPTEEVTKSGIVIPDTAKEKPQQGEVKAVGSGRILENGERVPMEVKV GDRVFYSKYAGTEVKIDGEEYLILRESDILGILE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtgttcagaccgcttcatgacagggttttggtgaaaccacttcccaccgaagaggtgacc aagagcgggattgtaattcctgacactgccaaagaaaaaccccagcaaggggaagtaaaa gccgtgggttccggccggattttagaaaacggcgagcgggtacccatggaagtaaaagtt ggtgaccgggtattttacagcaagtatgccggtaccgaagtgaaaattgatggtgaagag tatttaatcttacgggaaagcgatatcctcgggattttagaataa

DBGET integrated database retrieval system