Carboxydothermus hydrogenoformans: CHY_1446 Help Entry CHY_1446          CDS       T00287                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chy  Carboxydothermus hydrogenoformans Pathway chy01100   Metabolic pathways chy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CHY_1446 (acpP)    00074 Mycolic acid biosynthesis     CHY_1446 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CHY_1446 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABB13814 UniProt:  Q3AC56 LinkDB All DBs Position complement(1295469..1295702) Genome browser AA seq 77 aa AA seqDB search MAGVFERVKKIIVDQLGVEEDEVTMEASFIDDLGADSLDIVELIMAFEEEFELEIPDEDA EKIRTVGDAVNYIQERV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaggagtgtttgagcgggttaaaaaaataatcgtggatcaattaggagtcgaagaa gatgaagttactatggaagcatcgtttattgacgaccttggagcggattcattggacatt gtggagttaattatggcttttgaagaagagtttgaattagagatacccgatgaagatgcg gaaaaaattcgcaccgttggggatgctgttaactatattcaggagagagtttaa

DBGET integrated database retrieval system