Croceimicrobium hydrocarbonivorans: H4K34_08450 Help Entry H4K34_08450       CDS       T07152                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chyd  Croceimicrobium hydrocarbonivorans Pathway chyd01100   Metabolic pathways chyd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chyd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H4K34_08450    00074 Mycolic acid biosynthesis     H4K34_08450   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H4K34_08450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 Ribosomal_L50 DUF1409 Motif Other DBs NCBI-ProteinID:  QNR25861 UniProt:  A0A7H0VJG3 LinkDB All DBs Position complement(1870941..1871177) Genome browser AA seq 78 aa AA seqDB search MSEIASKVKAIIVDKLGVDENEVTNEASFTNDLGADSLDTVELIMEFEKEFDIQIPDDQA ENITTVGQAVAYIEEAKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagaaatcgcttctaaagtaaaagctatcatcgtagataagctaggagtagacgaa aacgaagtaaccaacgaagctagctttaccaatgatctgggtgcagactctctggacact gtagagctgattatggaattcgaaaaagaatttgacattcaaattccagacgaccaagca gaaaacattaccaccgttggtcaggcggttgcctatatcgaagaggctaaaaaataa

DBGET integrated database retrieval system