Campylobacter hyointestinalis: CHH_1039 Help Entry CHH_1039          CDS       T04651                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chyo  Campylobacter hyointestinalis Pathway chyo00998   Biosynthesis of various antibiotics chyo01100   Metabolic pathways chyo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chyo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CHH_1039    00074 Mycolic acid biosynthesis     CHH_1039   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CHH_1039 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  ANE32688 LinkDB All DBs Position complement(984346..984588) Genome browser AA seq 80 aa AA seqDB search MDKNEIFGILSNALTELFEMPKEKITLEAKIYEDLDIDSIDAIDLIDYIKRQTGHRLEPN DFKNVKTLGDIVDAVAKKFD NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggataaaaatgagatttttggaattctctcaaatgcattaactgagctttttgagatg cctaaagaaaagatcactttagaagcaaaaatttacgaagacctagatatcgacagtata gatgctatcgatttgatagactatatcaaaagacagactggtcataggctagaaccaaat gattttaagaatgtaaaaacactcggtgatatagttgatgcggtagctaaaaaatttgat taa

DBGET integrated database retrieval system