Campylobacter hyointestinalis: CHH_1040 Help Entry CHH_1040          CDS       T04651                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chyo  Campylobacter hyointestinalis Pathway chyo00998   Biosynthesis of various antibiotics chyo01100   Metabolic pathways chyo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chyo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CHH_1040    00074 Mycolic acid biosynthesis     CHH_1040   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CHH_1040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANE32689 LinkDB All DBs Position complement(984588..984839) Genome browser AA seq 83 aa AA seqDB search MIDEIKEMIIKDLNLEDVKPSDIDEDAPLFSDGLGLDSVDALELGLSIQKRYGIVLDPKT DNVKEIYRSVKTLANFIENSRSK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgatcgatgagatcaaagaaatgatcataaaagatctaaatttagaagatgtaaaacca tctgatatagatgaagatgcgccgctcttttcggacggtttgggacttgatagtgtcgat gctttggagcttgggctctctatacaaaagagatatggtattgttttagatccaaaaaca gataatgtcaaagaaatttatcgtagtgttaagacgttagctaattttatagaaaatagt aggagtaaatga

DBGET integrated database retrieval system