Campylobacter hyointestinalis: CHH_1373 Help Entry CHH_1373          CDS       T04651                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chyo  Campylobacter hyointestinalis Pathway chyo00998   Biosynthesis of various antibiotics chyo01100   Metabolic pathways chyo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chyo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CHH_1373 (acpP1)    00074 Mycolic acid biosynthesis     CHH_1373 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CHH_1373 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ANE32984 LinkDB All DBs Position 1325817..1326050 Genome browser AA seq 77 aa AA seqDB search MAVFDDVRDVVVEQLSVAPDAVKMESKIIEDLGADSLDVVELVMALEEKFEVEIPDSEAE KLISISDVVNYIDSIKK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgatgacgttagagacgtagttgttgagcaactaagtgttgcaccagat gcagttaaaatggaatcaaaaatcattgaagatttaggtgctgattcactagatgttgtt gaattagttatggctttagaagaaaaatttgaagtagaaattccagatagtgaagcagaa aaattaataagcatttctgatgttgtaaattatatagatagtataaaaaaataa

DBGET integrated database retrieval system