Citrus x clementina (clementine): CICLE_v10002551mg Help Entry CICLE_v10002551mg CDS       T02982                                  Name (RefSeq) hypothetical protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cic  Citrus x clementina (clementine) Pathway cic04145   Phagosome cic04148   Efferocytosis cic04620   Toll-like receptor signaling pathway cic05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cic00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CICLE_v10002551mg    04148 Efferocytosis     CICLE_v10002551mg  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     CICLE_v10002551mg  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     CICLE_v10002551mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cic04131]     CICLE_v10002551mg   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cic04147]     CICLE_v10002551mg    04031 GTP-binding proteins [BR:cic04031]     CICLE_v10002551mg Membrane trafficking [BR:cic04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     CICLE_v10002551mg  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     CICLE_v10002551mg   Macropinocytosis    Ras GTPases     CICLE_v10002551mg  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     CICLE_v10002551mg Exosome [BR:cic04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CICLE_v10002551mg   Exosomal proteins of other body fluids (saliva and urine)    CICLE_v10002551mg   Exosomal proteins of colorectal cancer cells    CICLE_v10002551mg   Exosomal proteins of bladder cancer cells    CICLE_v10002551mg GTP-binding proteins [BR:cic04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     CICLE_v10002551mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  18041714 NCBI-ProteinID:  XP_006435211 UniProt:  V4TFH9 LinkDB All DBs Position Unknown AA seq 169 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGSPAYIECSSKTQQFLMLL NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtcgaggttcataaagtgcgtcactgtcggtgacggcgccgtcggaaaaact tgcatgcttatttcttacaccagcaacactttcccaacggactatgtgccaactgtcttt gacaatttcagtgcgaatgtggttgttgatgggagtacggtcaacttagggttatgggac actgctggtcaggaggattacaatagattgagaccgttaagttatagaggagctgatgtg tttattcttgcattctcactgattagcaaggccagctatgaaaatgtcgccaagaagtgg attccagaactgaggcactatgcgcctggtgttccaataattcttgttgggactaagcta gatcttcgggatgataagcagttctttattgatcatccaggtgcagtaccaattactaca gctcagggagaggaactgaggaagctgattggatctcctgcatacatcgaatgtagttca aagacacaacagtttttgatgctgctataa

DBGET integrated database retrieval system