Citrus x clementina (clementine): CICLE_v10009505mg Help Entry CICLE_v10009505mg CDS       T02982                                  Name (RefSeq) hypothetical protein   KO K07897   Ras-related protein Rab-7A Organism cic  Citrus x clementina (clementine) Pathway cic04144   Endocytosis cic04145   Phagosome cic04148   Efferocytosis Brite KEGG Orthology (KO) [BR:cic00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     CICLE_v10009505mg    04145 Phagosome     CICLE_v10009505mg    04148 Efferocytosis     CICLE_v10009505mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cic04131]     CICLE_v10009505mg   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cic04147]     CICLE_v10009505mg    04031 GTP-binding proteins [BR:cic04031]     CICLE_v10009505mg Membrane trafficking [BR:cic04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     CICLE_v10009505mg Exosome [BR:cic04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CICLE_v10009505mg   Exosomal proteins of other body fluids (saliva and urine)    CICLE_v10009505mg   Exosomal proteins of colorectal cancer cells    CICLE_v10009505mg   Exosomal proteins of bladder cancer cells    CICLE_v10009505mg GTP-binding proteins [BR:cic04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     CICLE_v10009505mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA ATP_bind_1 GTP_EFTU RsgA_GTPase Septin nSTAND3 AAA_16 cobW AAA_7 AAA_24 ATPase_2 AAA_22 NTPase_1 PduV-EutP TniB AAA_5 NACHT SRPRB MCM RNA_helicase AAA_14 ATP-synt_ab ABC_tran DAP3 nSTAND1 Motif Other DBs NCBI-GeneID:  18055725 NCBI-ProteinID:  XP_006451165 UniProt:  V4UJI4 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ IWDTAGQERFQSLGVAFYHGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF VVLGNKTDVDGGNSRVVR NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atggcttctcgaagacgcatgctcctcaaagttataatcctcggagacagcggggttggg aagacttctttgatgaatcaatatgtgaaccgcaagtttagtaaccagtataaagcaacc attggggcagatttcttgaccaaagaagtccaatttgaggacaggcttttcactttgcag atatgggatacagctggacaggaaaggtttcaaagtcttggagtggctttctaccatggc gcagactgttgtgttcttgtgtatgatgtgaatgtcatgaaatcatttgataatctcaac aattggcgagaggagttcctgattcaggccagcccttctgatcctgaaaactttccattt gttgtattggggaacaagacagatgttgatggtggcaatagtcgagtggtaagatga

DBGET integrated database retrieval system