Citrus x clementina (clementine): CICLE_v10010023mg Help Entry CICLE_v10010023mg CDS       T02982                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism cic  Citrus x clementina (clementine) Pathway cic04145   Phagocytosis cic04517   IgSF CAM signaling cic04814   Motor proteins Brite KEGG Orthology (KO) [BR:cic00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     CICLE_v10010023mg  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     CICLE_v10010023mg   09142 Cell motility    04814 Motor proteins     CICLE_v10010023mg  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cic03037]     CICLE_v10010023mg    04812 Cytoskeleton proteins [BR:cic04812]     CICLE_v10010023mg Cilium and associated proteins [BR:cic03037]  Motile cilia and associated proteins   Dynein arm    CICLE_v10010023mg Cytoskeleton proteins [BR:cic04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      CICLE_v10010023mg SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Orcokinin Motif Other DBs NCBI-GeneID:  18055733 NCBI-ProteinID:  XP_006451181 UniProt:  V4UPP4 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MLEGKASIKETDMPVKMQVQAMASASQALDLYDVVDSISIATHIKKEFDKIYGGGWQCVV GSNFGCYFTHKHGTFIYFSLETLNFLIFKAAITPSS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgttggagggaaaagcttcgataaaagagacagacatgcccgtgaagatgcaggtccaa gccatggcctcagcttcgcaagcacttgatctctacgatgttgttgattccatttccatt gctacccacatcaaaaaggaatttgacaagatatatggaggtggatggcaatgtgtggtg ggttccaacttcggttgttatttcactcataagcacggcactttcatctatttctctctc gagactctcaatttcctcatcttcaaggccgccataaccccttcttcttga

DBGET integrated database retrieval system