Citrus x clementina (clementine): CICLE_v10017399mg Help Entry CICLE_v10017399mg CDS       T02982                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism cic  Citrus x clementina (clementine) Pathway cic03060   Protein export cic04141   Protein processing in endoplasmic reticulum cic04145   Phagosome Brite KEGG Orthology (KO) [BR:cic00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CICLE_v10017399mg    04141 Protein processing in endoplasmic reticulum     CICLE_v10017399mg  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CICLE_v10017399mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cic04131]     CICLE_v10017399mg   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cic02044]     CICLE_v10017399mg Membrane trafficking [BR:cic04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     CICLE_v10017399mg Secretion system [BR:cic02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    CICLE_v10017399mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  18052999 NCBI-ProteinID:  XP_006447050 UniProt:  V4UDF2 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MDAIDNVFDPLRDFAKDSLRLVKRCHKPDRKEFTKVAFRTAIGFVVMGFVGFFVKLIFIP INNIIVGSG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacgccatcgacaacgtcttcgatccgctcagagatttcgcaaaagacagcttgcgt ctcgtcaagaggtgtcacaagcccgatcgcaaagaattcacgaaggttgcgttccgtacg gcgatcggattcgttgtcatgggattcgtaggtttcttcgtcaagttgatcttcatccct atcaacaatattattgttggatctggataa

DBGET integrated database retrieval system