Citrus x clementina (clementine): CICLE_v10022723mg Help Entry CICLE_v10022723mg CDS       T02982                                  Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism cic  Citrus x clementina (clementine) Pathway cic03020   RNA polymerase cic03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cic00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CICLE_v10022723mg   09124 Replication and repair    03420 Nucleotide excision repair     CICLE_v10022723mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cic03021]     CICLE_v10022723mg    03400 DNA repair and recombination proteins [BR:cic03400]     CICLE_v10022723mg Transcription machinery [BR:cic03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CICLE_v10022723mg   RNA polymerase III system    RNA polymerase III      CICLE_v10022723mg   RNA polymerase I system    RNA polymerase I      CICLE_v10022723mg DNA repair and recombination proteins [BR:cic03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CICLE_v10022723mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 O-ag_pol_Wzy Motif Other DBs NCBI-GeneID:  18048958 NCBI-ProteinID:  XP_006442881 UniProt:  V4U1W1 LinkDB All DBs Position Unknown AA seq 146 aa AA seqDB search MSNIVLFEDIFVVEKIDPDGKKFDKVSRIEAHSQNCDMYMLLDVNSELYPMRVGDKFTMA LAHTLNLDGTPDTGYYTPGARKTLADKYEYIMHGKLFKIGDEGSGKSLKAEIYVSYGGLL MMLKGDPSYVSHFELDQRLFLLMRKL NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgtcgaatatagtactttttgaggatatttttgtggttgagaagatagacccggatggc aagaagtttgacaaggtttcccgcattgaagcacatagtcagaactgtgacatgtacatg ctactggatgtgaactcggagctatatcctatgcgtgttggtgataaattcacaatggct ttggctcacacgttaaatttggatggaacaccagatactggctattatactccaggtgcg agaaagacacttgctgacaagtatgaatacattatgcatgggaagctattcaagattgga gatgaaggttctggaaaatcacttaaagcggagatatatgtttcatatggtgggcttcta atgatgctcaagggggatccgtcttatgtctctcacttcgagcttgatcaaaggctgttt ctcctgatgaggaagttgtaa

DBGET integrated database retrieval system