Citrus x clementina (clementine): CICLE_v10024475mg Help Entry CICLE_v10024475mg CDS       T02982                                  Name (RefSeq) hypothetical protein   KO K02183   calmodulin Organism cic  Citrus x clementina (clementine) Pathway cic04016   MAPK signaling pathway - plant cic04070   Phosphatidylinositol signaling system cic04075   Plant hormone signal transduction cic04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:cic00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     CICLE_v10024475mg    04070 Phosphatidylinositol signaling system     CICLE_v10024475mg    04075 Plant hormone signal transduction     CICLE_v10024475mg  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     CICLE_v10024475mg  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cic01009]     CICLE_v10024475mg   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cic04131]     CICLE_v10024475mg    03036 Chromosome and associated proteins [BR:cic03036]     CICLE_v10024475mg   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cic04147]     CICLE_v10024475mg Protein phosphatases and associated proteins [BR:cic01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      CICLE_v10024475mg Membrane trafficking [BR:cic04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     CICLE_v10024475mg Chromosome and associated proteins [BR:cic03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      CICLE_v10024475mg Exosome [BR:cic04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    CICLE_v10024475mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 SPARC_Ca_bdg Dockerin_1 EF-hand_9 TerB EF-hand_FSTL1 EF-Ts_N DUF3741 Motif Other DBs NCBI-GeneID:  18048337 NCBI-ProteinID:  XP_006443407 UniProt:  V4TT96 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search ACRTKTWCDRQFWTPTEIVGCECAYSRELSRLFEEKEPSLEEVKDAFDVFDENKDGFIDA LELQRVLCILGMKEGFQLENCKKMIKTFDENGDGSIDFKEFVKFMESSFVES NT seq 339 nt NT seq  +upstreamnt  +downstreamnt gcctgtcgcaccaagacttggtgcgacaggcaattttggacaccaactgagattgttggc tgtgaatgcgcgtattccagagagctttccaggttgtttgaggagaaagaaccaagcttg gaggaggtgaaggatgcttttgatgtgtttgatgagaacaaagatggctttattgatgcc ctggagttgcagagagtgctctgtattttgggcatgaaagagggattccagctggagaac tgcaagaaaatgatcaaaacttttgatgaaaacggagatggaagtatagattttaaggaa tttgtaaagtttatggagagtagctttgttgaatcctaa

DBGET integrated database retrieval system