Citrus x clementina (clementine): CICLE_v10026831mg Help Entry CICLE_v10026831mg CDS       T02982                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism cic  Citrus x clementina (clementine) Pathway cic04814   Motor proteins Brite KEGG Orthology (KO) [BR:cic00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     CICLE_v10026831mg  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cic03037]     CICLE_v10026831mg    04812 Cytoskeleton proteins [BR:cic04812]     CICLE_v10026831mg Cilium and associated proteins [BR:cic03037]  Motile cilia and associated proteins   Dynein arm    CICLE_v10026831mg Cytoskeleton proteins [BR:cic04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      CICLE_v10026831mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  18036848 NCBI-ProteinID:  XP_006426959 UniProt:  V4ULE7 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MLEGKALIEDTDMPVKMQLYAMASASQALDVYDVFDCKSIAAHIKKEFDKRYGGGWQCVV GSNFGCFFTHTEGTFIYFQLETLKFLIFKGSSSPPPTSH NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgctggaaggcaaagctttgattgaagatacagatatgccagtgaagatgcagttgtat gccatggcttctgcttctcaagctcttgatgtttatgatgtttttgattgcaaatccatt gctgcccacataaaaaaggagtttgacaaaagatatgggggagggtggcaatgtgtggtg ggatcaaatttcggttgtttctttacacatactgaggggacattcatttattttcaattg gagactctcaagtttctcatcttcaaaggttcttcttctcctcctcccaccagtcattga

DBGET integrated database retrieval system