Citrus x clementina (clementine): CICLE_v10033494mg Help Entry CICLE_v10033494mg CDS       T02982                                  Name (RefSeq) hypothetical protein   KO K13113   ubiquitin-like protein 5 Organism cic  Citrus x clementina (clementine) Brite KEGG Orthology (KO) [BR:cic00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:cic03041]     CICLE_v10033494mg   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cic04052]     CICLE_v10033494mg Spliceosome [BR:cic03041]  Complex B   Other components    Complex B specific factors     CICLE_v10033494mg Cytokines and neuropeptides [BR:cic04052]  Neuropeptides   Unclassified    CICLE_v10033494mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL PI3K_rbd Motif Other DBs NCBI-GeneID:  18045712 NCBI-ProteinID:  XP_006436432 UniProt:  V4T8X4 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MGKSKQETKMIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIY KDHITLKDYEIHDGMGLELYYS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgggaaaatcaaaacaggagacaaagatgattgaggtggtgctgaacgacaggctcggg aagaaggtgcgcgtgaagtgcaacgaagacgacaccataggcgacttgaagaagctggtg gcggctcagaccgggactcgagccgacaagattcggattcagaagtggtacaacatctac aaggaccacatcactctcaaggactacgagattcacgacggcatgggcctcgaactctat tacagctaa

DBGET integrated database retrieval system