Citrus x clementina (clementine): CICLE_v10033670mg Help Entry CICLE_v10033670mg CDS       T02982                                  Name (RefSeq) hypothetical protein   KO K11252   histone H2B Organism cic  Citrus x clementina (clementine) Brite KEGG Orthology (KO) [BR:cic00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cic03036]     CICLE_v10033670mg   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cic04147]     CICLE_v10033670mg Chromosome and associated proteins [BR:cic03036]  Eukaryotic type   Nucleosome assembly factors    Histones     CICLE_v10033670mg Exosome [BR:cic04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CICLE_v10033670mg BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  18045138 NCBI-ProteinID:  XP_006438212 UniProt:  V4TDR8 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MTKKPKVGKKLLKKAASSNKEKKCAKKSIKMYKIYIFKVLKQEFARYKKKPTITSWEFQT VGRLVLPGELAKHIVSEGTKAVSKFTY NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacgaagaagccaaaggttgggaagaaacttctgaagaaagctgcctctagcaacaag gagaagaagtgtgccaagaaaagcatcaagatgtacaagatctacatcttcaaagtccta aagcaagagtttgcaaggtacaagaagaagccaacgattacatcttgggaatttcaaacc gttgggagacttgtgcttcctggtgagctagctaagcacattgtttctgagggtaccaag gctgtttctaagtttacttattga

DBGET integrated database retrieval system