Celeribacter indicus: P73_0086 Help Entry P73_0086          CDS       T03575                                  Name (GenBank) flagellar protein FlgJ   KO K02395   peptidoglycan hydrolase FlgJ Organism cid  Celeribacter indicus Pathway cid02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:cid00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     P73_0086  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:cid02035]     P73_0086 Bacterial motility proteins [BR:cid02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     P73_0086 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  AJE44801 UniProt:  A0A0B5DVL3 LinkDB All DBs Position 85036..85320 Genome browser AA seq 94 aa AA seqDB search MHVSPKPPPETAGPPGTEERLRTVSRQLEATFLAEMLKSAGFGQTREAFGGGAGEDQFSS FLVHAQAEKMVEAGGLGLAEQIFNALRETIHDDP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgcatgtctccccgaaaccgccgcccgaaaccgccgggccgccagggacggaggaaagg ctgcgcaccgtctcgcgtcagctcgaagccacgtttctggccgagatgttgaagagtgct ggcttcggccagacgcgcgaggcgttcggaggcggggcaggcgaggatcagttctcgtcc ttcctcgtgcatgcgcaagccgagaaaatggtcgaggcgggggggctgggacttgccgaa cagattttcaacgcgctgcgggagaccatccatgacgatccttga

DBGET integrated database retrieval system